Ferredoxin [4Fe-4S]

This Pyrococcus furiosus Ferredoxin contains a single low potential [4Fe-4S] cluster. It is used to donate to and accept electrons from a variety of oxidoreductase-type enzymes.

Highlights:

  • Purity of >90%
  • Highly thermostable - active over broad range (up to 100°C)
  • Can be used as an electron donor/acceptor with various oxidoreductase-type enzymes

Ferredoxins are iron-sulfur proteins that mediate electron transfer in a range of metabolic reactions. The iron-sulfur clusters of ferredoxins can accept or discharge electrons, the effect being change in the oxidation states (+2 or +3) of the iron atoms. In this way, ferredoxin acts as electron transfer agents in biological redox reactions.

From the laboratory of Michael W. W. Adams, PhD, University of Georgia.

Catalog Number Product DataSheet Size AVAILABILITY Price Qty
EGA302
Ferredoxin [4Fe-4S]
200ug (5.6mg/mL) In stock
Regular Price:$53.00
On Sale:
Specifications

Product Type: Protein
Name: Ferredoxin (single [4Fe-4S] clusters)
Accession ID: PF1909, NP_579638.1
Source: Pyrococcus furiosus
Molecular Weight: 7.2 kDa
Amino Acid Sequence: MAWKVSVDQDTCIGDAICASLCPDVFEMNDEGKAQPKVEVIEDEELYNCAKEAMEACPVSAITIEEA
Fusion Tag(s): None
Purity: >90%
Buffer: 50 mM Tris, 200 mM NaCl, pH 8.0
Concentration: 5.6mg/mL
Comments: Single low potential [4Fe-4S] cluster
Storage: Frozen at -20°C or below, but stable at room temperature
Shipped: Ambient temperature

Provider
From the laboratory of Michael W. W. Adams, PhD, University of Georgia.
References
  1. Kim, C. H., Brereton, P. S., Verhagen, M. F. J. M. and Adams, M. W. W. (2001) “Ferredoxin from Pyrococcus furiosus” Meths. Enzymol. 334, 30-40

If you publish research with this product, please let us know so we can cite your paper.

Loading...