This Pyrococcus furiosus Ferredoxin contains a single low potential [4Fe-4S] cluster. It is used to donate to and accept electrons from a variety of oxidoreductase-type enzymes.
Highlights:
Ferredoxins are iron-sulfur proteins that mediate electron transfer in a range of metabolic reactions. The iron-sulfur clusters of ferredoxins can accept or discharge electrons, the effect being change in the oxidation states (+2 or +3) of the iron atoms. In this way, ferredoxin acts as electron transfer agents in biological redox reactions.
From the laboratory of Michael W. W. Adams, PhD, University of Georgia.
Product Type: | Protein |
Name: | Ferredoxin (single [4Fe-4S] clusters) |
Accession ID: | PF1909, NP_579638.1 |
Source: | Pyrococcus furiosus |
Molecular Weight: | 7.2 kDa |
Amino Acid Sequence: | MAWKVSVDQDTCIGDAICASLCPDVFEMNDEGKAQPKVEVIEDEELYNCAKEAMEACPVSAITIEEA |
Fusion Tag(s): | None |
Purity: | >90% |
Buffer: | 50 mM Tris, 200 mM NaCl, pH 8.0 |
Concentration: | 5.6mg/mL |
Comments: | Single low potential [4Fe-4S] cluster |
Storage: | Frozen at -20°C or below, but stable at room temperature |
Shipped: | Ambient temperature |
If you publish research with this product, please let us know so we can cite your paper.