Recombinant Human ACE2-NN-IgG Fc (LALA)-Fusion Protein

Recombinant human ACE2-NN-IgG Fc (LALA)-Fusion Protein expressed in HEK293 cells.

Highlights:

  • ACE2-NN is the inactivate form of ACE2
  • Prolongs of the plasma half-life (t1/2) of the protein of interest in vivo, resulting in improved therapeutic efficacy
  • In vitro applications of Fc-Fusion proteins include immunohistochemistry (IHC), flow cytometry (FC), protein binding assays, and use as microarray baits
  • Fc domain-Fusion can also improve the in vivo and in vitro solubility and stability of some binding partners

ACE2 acts as a receptor for human coronaviruses SARS-CoV and SARS-CoV-2, as well as human coronavirus NL63/HCoV-NL63. ACE2-NN is its inactivated mutant form (H374N and H378N mutations).

From our sister company Absolute Antibody.

Catalog Number Product DataSheet Size AVAILABILITY Price Qty
Kf-Pr00441
Recombinant Human ACE2-NN-IgG Fc (LALA)-Fusion Protein
0.1mg In stock
Regular Price:$295.00
On Sale:

For larger sizes, please Contact Us for a bulk discount.

Specifications

Product Type: Protein
Alternative Name(s): ACE2-NN-Fc chimera; ACE2-NN (Fc tag); ACEH; Metalloprotease MPROT15
Accession ID: Q9BYF1
Fc domain: Human IgG1 containing silencing LALA mutations
Host: HEK293
Source: Recombinant
Species: Human
Extinction Coefficient: 376360 M-1 cm-1 (calculation performed as in Pace et al, 1995)
Molecular Weight: 190493.08 Da
Amino Acid Sequence: QSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKL QLQALQQNGSSVLSEDKSKRLNTILNTMSTIYSTGKVCNPDNPQECLLLEPGLNEIMANSLDYNERLWAWESWRSEV GKQLRPLYEEYVVLKNEMARANHYEDYGDYWRGDYEVNGVDGYDYSRGQLIEDVEHTFEEIKPLYEHLHAYVRAKLM NAYPSYISPIGCLPAHLLGDMWGRFWTNLYSLTVPFGQKPNIDVTDAMVDQAWDAQRIFKEAEKFFVSVGLPNMTQG FWENSMLTDPGNVQKAVCHPTAWDLGKGDFRILMCTKVTMDDFLTAHNEMGNIQYDMAYAAQPFLLRNGANEGFHE AVGEIMSLSAATPKHLKSIGLLSPDFQEDNETEINFLLKQALTIVGTLPFTYMLEKWRWMVFKGEIPKDQWMKKWWEM KREIVGVVEPVPHDETYCDPASLFHVSNDYSFIRYYTRTLYQFQFQEALCQAAKHEGPLHKCDISNSTEAGQKLFNML RLGKSEPWTLALENVVGAKNMNVRPLLNYFEPLFTWLKDQNKNSFVGWSTDWSPYADGGGGSGGGGSDKTHTCPP CPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSV LTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESN GQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Purity: >95% (SDS-PAGE)
Buffer: PBS, 0.02% Proclin 300
Concentration: 1 mg/mL
Activity: ACE2 acts as a receptor for human coronaviruses SARS-CoV and SARS-CoV-2, as well as human coronavirus NL63/HCoV-NL63. ACE2-NN is its inactivated mutan
Storage: Recommended storage at +4C for up to 1 month. For longer term storage store at -20C or -80C in appropriate sized aliquots.
Shipped: Cold packs

Documentation
Data

ELISA: ACE2 Fc fusion protein binding to immobilized SARS-CoV-2 RBD Fc fusion protein. 96-well plate was coated with the SARS-CoV-2 RBD Fc fusion protein at 5 ug/ml. The ACE2 Fc fusion protein (Kf-Pr00439) were titrated on a 3-fold serial dilution starting at 10 ug/ml.

RBD Fc binding to immobilized ACE2 Fc fusion proteins. 96-well plates were coated with the ACE2 Fc fusion proteins (Kf-Pr00439 and Kf-Pr00441) at 5 ug/ml. The SARS-CoV-2 RBD Fc fusion protein conjugated to HRP was titrated on a 3-fold serial dilution starting at 10 ug/ml.

Provider
From our sister company Absolute Antibody.
Comments
ACE2-NN-Ig was generated from ACE2-Ig by altering the codons of ACE2 active-site histidines 374 and 378 to those of asparagines, using the QuikChange method. Fc fragment has silencing LALA mutations introduced.
References

If you publish research with this product, please let us know so we can cite your paper.

Loading...