Recombinant Human ACE2-IgG Fc (LALA)-Fusion Protein

Recombinant human ACE2-IgG Fc (LALA)-Fusion Protein expressed in HEK293 cells.

Highlights:

  • Prolongs of the plasma half-life (t1/2) of the protein of interest in vivo, resulting in improved therapeutic efficacy
  • In vitro applications of Fc-Fusion proteins include immunohistochemistry (IHC), flow cytometry (FC), protein binding assays, and use as microarray baits
  • Fc domain-Fusion can also improve the in vivo and in vitro solubility and stability of some binding partners

ACE2 acts as a receptor for human coronaviruses SARS-CoV and SARS-CoV-2, as well as human coronavirus NL63/HCoV-NL63. ACE2-NN is its inactivated mutant form.

From our sister company Absolute Antibody.

Catalog Number Product DataSheet Size AVAILABILITY Price Qty
Kf-Pr00439
Recombinant Human ACE2-IgG Fc (LALA)-Fusion Protein
0.1mg In stock
Regular Price:$295.00
On Sale:

For larger sizes, please Contact Us for a bulk discount.

Specifications

Product Type: Protein
Alternative Name(s): ACE2 -Fc chimera; ACE2 (Fc tag); ACEH; Metalloprotease MPROT15
Accession ID: Q9BYF1
Fc domain: Human IgG1 containing silencing LALA mutations
Host: HEK293
Source: Recombinant
Species: Human
Extinction Coefficient: 376360 M-1 cm-1 (calculation performed as in Pace et al, 1995)
Molecular Weight: 190585.2 Da
Amino Acid Sequence: QSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKL QLQALQQNGSSVLSEDKSKRLNTILNTMSTIYSTGKVCNPDNPQECLLLEPGLNEIMANSLDYNERLWAWESWRSEV GKQLRPLYEEYVVLKNEMARANHYEDYGDYWRGDYEVNGVDGYDYSRGQLIEDVEHTFEEIKPLYEHLHAYVRAKLM NAYPSYISPIGCLPAHLLGDMWGRFWTNLYSLTVPFGQKPNIDVTDAMVDQAWDAQRIFKEAEKFFVSVGLPNMTQG FWENSMLTDPGNVQKAVCHPTAWDLGKGDFRILMCTKVTMDDFLTAHHEMGHIQYDMAYAAQPFLLRNGANEGFHE AVGEIMSLSAATPKHLKSIGLLSPDFQEDNETEINFLLKQALTIVGTLPFTYMLEKWRWMVFKGEIPKDQWMKKWWEM KREIVGVVEPVPHDETYCDPASLFHVSNDYSFIRYYTRTLYQFQFQEALCQAAKHEGPLHKCDISNSTEAGQKLFNML RLGKSEPWTLALENVVGAKNMNVRPLLNYFEPLFTWLKDQNKNSFVGWSTDWSPYADGGGGSGGGGSDKTHTCPP CPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSV LTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESN GQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Purity: >95% (SDS-PAGE)
Buffer: PBS, 0.02% Proclin 300
Concentration: 1 mg/mL
Activity: ACE2 acts as a receptor for human coronaviruses SARS-CoV and SARS-CoV-2, as well as human coronavirus NL63/HCoV-NL63.
Storage: Recommended storage at +4C for up to 1 month. For longer term storage store at -20C or -80C in appropriate sized aliquots.
Shipped: Cold packs

Documentation
Data

ELISA: ACE2 Fc fusion protein binding to immobilized SARS-CoV-2 RBD Fc fusion protein. 96-well plate was coated with the SARS-CoV-2 RBD Fc fusion protein at 5 ug/ml. The ACE2 Fc fusion protein (Kf-Pr00439) were titrated on a 3-fold serial dilution starting at 10 ug/ml.

RBD Fc binding to immobilized ACE2 Fc fusion proteins. 96-well plates were coated with the ACE2 Fc fusion proteins (Kf-Pr00439 and Kf-Pr00441) at 5 ug/ml. The SARS-CoV-2 RBD Fc fusion protein conjugated to HRP was titrated on a 3-fold serial dilution starting at 10 ug/ml.

Provider
From our sister company Absolute Antibody.
References

If you publish research with this product, please let us know so we can cite your paper.

Loading...