Recombinant mouse VISTA Fc-Fusion Protein
Recombinant human VISTA Fc-Fusion Protein expressed in HEK293 cells.
Highlights:
- Prolongs of the plasma half-life (t1/2) of the protein of interest in vivo, resulting in improved therapeutic efficacy
- In vitro applications of Fc-Fusion proteins include immunohistochemistry (IHC), flow cytometry (FC), protein binding assays, and use as microarray baits
- Fc domain-Fusion can also improve the in vivo and in vitro solubility and stability of some binding partners
V-type immunoglobulin domain-containing suppressor of T-cell activation (VISTA) is an immunoregulatory receptor which inhibits the T-cell response. It may promote differentiation of embryonic stem cells, by inhibiting BMP4 signalin, and may stimulate MMP14-mediated MMP2 activation.
From our sister company Absolute Antibody.
Recombinant human VISTA Fc-Fusion Protein expressed in HEK293 cells.
Highlights:
- Prolongs of the plasma half-life (t1/2) of the protein of interest in vivo, resulting in improved therapeutic efficacy
- In vitro applications of Fc-Fusion proteins include immunohistochemistry (IHC), flow cytometry (FC), protein binding assays, and use as microarray baits
- Fc domain-Fusion can also improve the in vivo and in vitro solubility and stability of some binding partners
V-type immunoglobulin domain-containing suppressor of T-cell activation (VISTA) is an immunoregulatory receptor which inhibits the T-cell response. It may promote differentiation of embryonic stem cells, by inhibiting BMP4 signalin, and may stimulate MMP14-mediated MMP2 activation.
From our sister company Absolute Antibody.
For larger sizes, please Contact Us for a bulk discount.
Specifications
| Product Type: | Protein |
| Alternative Name(s): | V-type immunoglobulin domain-containing suppressor of T-cell activation, Platelet receptor Gi24, V-set domain-containing immunoregulatory receptor, V-set immunoregulatory receptor |
| Antigen: | VISTA |
| Accession ID: | Q9D659 |
| Species: | mouse |
| Fc domain: | mouse IgG1 |
| Host: | HEK293 |
| Molecular Weight: | 88947 Da |
| Extinction Coefficient: | 97900 |
| Amino Acid Sequence: | AFKVTTPYSLYVCPEGQNATLTCRILGPVSKGHDVTIYKTWYLSSRGEVQMCKEHRPIRNFTLQHLQHHGSHLKANASHDQPQKHGLELASDHHGNFSITLRNVTPRDSGLYCCLVIELKNHHPEQRFYGSMELQVQAGKGSGSTCMASNEQDSDSITAGGGGSVPRDQGCKPCICTVPEVSSVFIFPPKPKDVLTITLTPKVTCVVVDISKDDPEVQFSWFVDDVEVHTAQTKPREEQINSTFRSVSELPIMHQDWLNGKEFKCRVNSAAFPAPIEKTISKTKGRPKAPQVYTIPPPKEQMAKDKVSLTCMITNFFPEDITVEWQWNGQPAENYKNTQPIMDTDGSYFVYSKLNVQKSNWEAGNTFTCSVLHEGLHNHHTEKSLSHSPGKHHHHHH |
| Purity: | >95% (SDS-PAGE) |
| Buffer: | PBS + 0.02% Proclin 300 |
| Amount: | 0.1mg |
| Activity: | Immunoregulatory receptor which inhibits the T-cell response (PubMed:21383057, PubMed:24743150, PubMed:25267631). May promote differentiation of embryonic stem cells, by inhibiting BMP4 signaling (PubMed:20042595). May stimulate MMP14-mediated MMP2 activation (By similarity) [Uniprot]. |
| Mycoplasma Tested: | <1.0 EU/mg |
| Storage: | Store at 4C up to 1 month. Small volumes at -20C for longer storage. |
| Shipped: | Cold packs |
Documentation
References
If you publish research with this product, please let us know so we can cite your paper.
