Recombinant human NCTR3 Fc-Fusion Protein
Recombinant human NCTR3 Fc-Fusion Protein expressed in HEK293 cells.
Highlights:
- Prolongs of the plasma half-life (t1/2) of the protein of interest in vivo, resulting in improved therapeutic efficacy
- In vitro applications of Fc-Fusion proteins include immunohistochemistry (IHC), flow cytometry (FC), protein binding assays, and use as microarray baits
- Fc domain-Fusion can also improve the in vivo and in vitro solubility and stability of some binding partners
Natural cytotoxicity triggering receptor 3 (NCTR3) is a cell membrane receptor of natural killer/NK cells that is activated by binding of extracellular ligands including BAG6 and NCR3LG1. Stimulates NK cells cytotoxicity toward neighboring cells producing these ligands. It controls, for instance, NK cells cytotoxicity against tumor cells. Engagement of NCR3 by BAG6 also promotes myeloid dendritic cells (DC) maturation, both through killing DCs that did not acquire a mature phenotype, and inducing the release by NK cells of TNFA and IFNG which promote DC maturation.
From our sister company Absolute Antibody.
Recombinant human NCTR3 Fc-Fusion Protein expressed in HEK293 cells.
Highlights:
- Prolongs of the plasma half-life (t1/2) of the protein of interest in vivo, resulting in improved therapeutic efficacy
- In vitro applications of Fc-Fusion proteins include immunohistochemistry (IHC), flow cytometry (FC), protein binding assays, and use as microarray baits
- Fc domain-Fusion can also improve the in vivo and in vitro solubility and stability of some binding partners
Natural cytotoxicity triggering receptor 3 (NCTR3) is a cell membrane receptor of natural killer/NK cells that is activated by binding of extracellular ligands including BAG6 and NCR3LG1. Stimulates NK cells cytotoxicity toward neighboring cells producing these ligands. It controls, for instance, NK cells cytotoxicity against tumor cells. Engagement of NCR3 by BAG6 also promotes myeloid dendritic cells (DC) maturation, both through killing DCs that did not acquire a mature phenotype, and inducing the release by NK cells of TNFA and IFNG which promote DC maturation.
From our sister company Absolute Antibody.
For larger sizes, please Contact Us for a bulk discount.
| Product Type: | Protein |
| Alternative Name(s): | Natural cytotoxicity triggering receptor 3, Activating natural killer receptor p30, Natural killer cell p30-related protein, NK-p30, NKp30, CD337 |
| Accession ID: | O14931 |
| Antigen: | NCTR3 |
| Host: | HEK293 |
| Fc domain: | human IgG1 |
| Species: | human |
| Extinction Coefficient: | 97000 |
| Molecular Weight: | 80557.34 Da |
| Amino Acid Sequence: | LWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLGAGTVGGGGSEPKSQDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGHHHHHH |
| Purity: | >95% (SDS-PAGE) |
| Buffer: | PBS + 0.02% Proclin 300 |
| Amount: | 0.1mg |
| Activity: | Cell membrane receptor of natural killer/NK cells that is activated by binding of extracellular ligands including BAG6 and NCR3LG1. Stimulates NK cells cytotoxicity toward neighboring cells producing these ligands. It controls, for instance, NK cells cytotoxicity against tumor cells. Engagement of NCR3 by BAG6 also promotes myeloid dendritic cells (DC) maturation, both through killing DCs that did not acquire a mature phenotype, and inducing the release by NK cells of TNFA and IFNG which promote DC maturation [Uniprot]. |
| Mycoplasma Tested: | <1.0 EU/mg |
| Storage: | Store at 4C up to 1 month. Small volumes at -20C for longer storage. |
| Shipped: | Cold packs |
If you publish research with this product, please let us know so we can cite your paper.
