GST-PAK-CRIB Rac/Cdc42 Isolation Kit

Recombinant protein purified from E. coli, consisting of GST fused to the Cdc42 (p21) binding domain (CRIB) of the human p21 activated kinase 1 protein (PAK).

Highlights:

  • Specifically binds to GTP-bound (but not GDP-bound) Cdc42 small GTPase for precipitation of active, GTP-bound Cdc42 from cell lysates
  • Contains the highly conserved CRIB motif plus sequences required for the high affinity interaction with GTP-Cdc42
  • Provided as GST-PAK-CRIB non-covalently bound to glutathione agarose

This non-radioactive pulldown assay uses the p21 binding domain (PBD) of the Rac/Cdc42, p21-activated protein kinase (PAK1). This domain is expressed as an N-terminal GST-fusion protein coupled to glutathione beads and can be used to isolate the active, GTP-bound form of Rac/Cdc42 from whole cell lysates. After precipitation, Rac/Cdc42 can be detected by immunoblotting with the appropriate antibodies.

From the laboratory of Jorrit M. Enserink, PhD, University of Oslo.

Catalog Number Product DataSheet Size AVAILABILITY Price Qty
EOS001
GST-PAK-CRIB Rac/Cdc42 Isolation Kit
25uL In stock
Regular Price:$359.00
On Sale:
Specifications

Product Type: Protein
Name: GST-PAK-CRIB
Source: E. coli
Molecular Weight: 34 kDa GST fusion protein
Amino Acid Sequence: RSILPGDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKNPQAVLDVLEFYNSKKTSNSQKYMSFTDKSA
Fusion Tag(s): GST
Purity: >90%
Buffer: 30% glycerol, PBS pH7.4, 2 mM EDTA, 10 mM DTT, protease inhibitors
Storage: -80C
Shipped: Dry ice

Documentation

Protocol Information

Recommended amount of beads per assayed sample: 2-2.5 µl (higher amounts are unnecessary and may even negatively affect experimental outcome).

Data
Provider
From the laboratory of Jorrit M. Enserink, PhD, University of Oslo.
References
  1. Benard V, Bohl BP, Bokoch GM. Characterization of rac and cdc42 activation in chemoattractant-stimulated human neutrophils using a novel assay for active GTPases. J Biol Chem. 1999 May 7;274(19):13198-204.

If you publish research with this product, please let us know so we can cite your paper.

Loading...