MTB DapE protein, RMTB003
Recombinant MTB DapE protein, produced from E. coli.
DapE also known as succinyl-diaminopimelate desuccinylase, is a 37 kDa membrane bound hydrolase enzyme which Catalyzes the hydrolysis of N-succinyl-L,L-diaminopimelic acid (SDAP), forming succinate and LL-2,6-diaminoheptanedioate (DAP), an intermediate involved in the bacterial biosynthesis of lysine and meso-diaminopimelic acid. It is conserved across M. tuberculosis, M. orygis, M. mungi, M. africanum and M. bovis strain of TB causing Mycobacterium.
Recombinant MTB DapE protein, produced from E. coli.
DapE also known as succinyl-diaminopimelate desuccinylase, is a 37 kDa membrane bound hydrolase enzyme which Catalyzes the hydrolysis of N-succinyl-L,L-diaminopimelic acid (SDAP), forming succinate and LL-2,6-diaminoheptanedioate (DAP), an intermediate involved in the bacterial biosynthesis of lysine and meso-diaminopimelic acid. It is conserved across M. tuberculosis, M. orygis, M. mungi, M. africanum and M. bovis strain of TB causing Mycobacterium.
| Catalog Number | Product | DataSheet | Size | AVAILABILITY | Price | Qty |
|---|
Specifications
| Product Type: | Protein |
| Name: | MTB DapE protein |
| Accession ID: | P9WHS8 |
| Source: | Expressed recombinantly in E. coli |
| Molecular Weight: | 37.2 kDa |
| Amino Acid Sequence: | MASGRGDPIELTAALIDIPSESRKEARIADEVEAALRAQASGFEIIRNGNAVLARTK LNRSSRVLLAGHLDTVPVAGNLPSRRENDQLHGCGAADMKSGDAVFLHLAATLA EPTHDLTLVFYDCEEIDSAANGLGRIQRELPDWLSADVAILGEPTAGCIEAGCQGTL RVVLSVTGTRAHSARSWLGDNAIHKLGAVLDRLAVYRARSVDIDGCTYREGLSAV RVAGGVAGNVIPDAASVTINYRFAPDRSVAAALQHVHDVFDGLDVQIEQTDAA AGALPGLSEPAAKALVEAAGGQVRAKYGWTDVSRFAALGIPAVNYGPGDPNLAH CRDERVPVGNITAAVDLLRRYLG |
| Fusion Tag(s): | C-terminus 6 _ His tag |
| Format: | Lyophilized powder. Dilute to 1 mg/mL in PBS |
| Purity: | >95 %, pure on CBB |
| Buffer: | PBS |
| Tested Applications: | Tuberculosis research |
| Comments: | Manufactured in an ISO 9001:20015 Certified Laboratory |
| Storage: | Store at -20 degree C, for extended storage |
Documentation
Provider
From the laboratory at GeNext Genomics Pvt Ltd.
References
- Umbarkar C, Thakre P, Kashikar S, Ghanwate N, Agarkar V. N-Succinyl-L,L-Diaminopimelic Acid Desuccinylase (DapE) a Potential Biomarker of Mycobacterium Tuberculosis: Tag-Free Purification by Metal Affinity Chromatography: Tag-free purification of DapE by metal affinity chromatography. Trends Pept. Protein Sci. [Internet]. 2020Sep.8 [cited 2022Nov.16];5:1-9 (e4).
- Reinhard L, Mueller-Dieckmann J, Weiss MS. Cloning, expression, purification, crystallization and preliminary X-ray diffraction analysis of succinyl-diaminopimelate desuccinylase (Rv1202, DapE) from Mycobacterium tuberculosis. Acta Crystallogr Sect F Struct Biol Cryst Commun. 2012 Sep 1;68(Pt 9):1089-93. doi: 10.1107/S174430911203062X. Epub 2012 Aug 31. PMID: 22949202; PMCID: PMC3433205.
If you publish research with this product, please let us know so we can cite your paper.
