Cry1Ac toxin, RBT001

Recombinant Cry1Ac toxin protein, produced from E. coli.

Cry1Ac toxin is a protein coded by the Bt gene. Originally expressed by Bacillus thuringiensis, the Bt gene is cloned into transgenic crops to generate the Cry1Ac protein, thus conferring pest-resistant to the plants.

Catalog Number Product DataSheet Size AVAILABILITY Price Qty
FGN037
Cry1Ac toxin, RBT001
100ug In stock
Regular Price:$217.30
On Sale:
Specifications

Product Type: Protein
Name: Cry1Ac toxin
Accession ID: P05068
Source: Expressed recombinantly in E. coli
Molecular Weight: 62.8 kDa
Amino Acid Sequence: MDNNPNINECIPYNCLSNPEVEVLGGERIETGYTPIDISLSLTQFLLSEFVPGAGFVLGLVDIIWGIFG PSQWDAFLVQIEQLINQRIEEFARNQAISRLEGLSNLYQIYAESFREWEADPTNPALREEMRIQFN DMNSALTTAIPLFAVQNYQVPLLSVYVQAANLHLSVLRDVSVFGQRWGFDAATINSRYNDLTRLI GNYTDYAVRWYNTGLERVWGPDSRDWVRYNQFRRELTLTVLDIVALFPNYDSRRYPIRTVSQLT REIYTNPVLENFDGSFRGSAQGIERSIRSPHLMDILNSITIYTDAHRGYYYWSGHQIMASPVGFSGP EFTFPLYGTMGNAAPQQRIVAQLGQGVYRTLSSTLYRRPFNIGINNQQLSVLDGTEFAYGTSSNLP SAVYRKSGTVDSLDEIPPQNNNVPPRQGFSHRLSHVSMFRSGFSNSSVSIIRAPMFSWIHRSAEFN NIIASDSITQIPAVKGNFLFNGSVISGPGFTGGDLVRLNSSGNNIQNRGYIEVPIHFPSTSTRYRVRV RYASVTPIHLNVNWGYSSIFSNTVPATATSLDNLQSSDFGYFESANAFTSSLGNIVGVRNFSGTAG VIIDGFEFIPVT
Fusion Tag(s): C-terminus 6 _ His tag
Format: Lyophilized powder. Dilute to 1 mg/mL in PBS
Purity: >95 %, purified by Ni NTA and determined by SDS-PAGE.
Buffer: PBS
Tested Applications: Cotton research
Comments: Manufactured in an ISO 9001:20015 Certified Laboratory
Storage: Store at -20 degree C, for extended storage

Documentation
Provider
From the laboratory at GeNext Genomics Pvt Ltd.
References

If you publish research with this product, please let us know so we can cite your paper.

Loading...