Classical Swine Fever Virus E2 glycoporotein, rCSFE2-1

Recombinant classical swine fever (CSF) cholera virus (HCV) E2 glycoprotein, produced from E. coli.

Classical swine fever (CSF) or hog cholera virus (HCV) is a highly contagious disease of pigs and wild boars. The E2 glycoprotein is the most immunogenic CSFV protein responsible for the disease.

Catalog Number Product DataSheet Size AVAILABILITY Price Qty
FGN028
Classical Swine Fever Virus E2 glycoporotein, rCSFE2-1
100ug 1-2 weeks
Regular Price:$221.10
On Sale:
FGN029
Classical Swine Fever Virus E2 glycoporotein, rCSFE2-1
500ug 1-2 weeks
Regular Price:$663.40
On Sale:
FGN030
Classical Swine Fever Virus E2 glycoporotein, rCSFE2-1
1mg 1-2 weeks
Regular Price:$995.00
On Sale:
Specifications

Product Type: Protein
Name: Classical Swine Fever Virus E2 glycoporotein
Accession ID: P19712
Source: Expressed recombinantly in E. coli
Molecular Weight: 38 kDa
Amino Acid Sequence: 31-GAQGRLACKEDYRYAISSTNEIGPLGARGLTTTWKEFSYGLQLNDGTVKAICVAGSFKATALNVVS RRYLASLHKRALPTSVTFELLFDGTNPSTEEMGDDFGFGLCPFNTSPVVKGKYNTTLLNGSAFYLVC PIGWTGVIECTAVSPTTLRTEVVKTFRREKPFPHRMDCLTTTVENEDLFYCKLGGNWTCVKGEPVV YTGGQVKQCRWCGFDFNEPDGLPHYPIGKCILANETGYRIVDSTDCNRDGVVISTEGSHECLIGNT TVKVHASDGRLGPMPCRPKEIVSSAGPVRKTSCTFKYAKTLKNKYYEPRDSYFQQYMLKGEYQYW FDLDVTDRHSD-371
Fusion Tag(s): C-terminus 6 _ His tag
Format: Lyophilized powder. Dilute to 1 mg/mL in PBS
Purity: >95 %, purified by Ni NTA and determined by SDS-PAGE.
Buffer: PBS
Tested Applications: Classical swine fever research
Comments: Manufactured in an ISO 9001:20015 Certified Laboratory
Storage: Store at -20 degree C, for extended storage

Documentation
Provider
From the laboratory at GeNext Genomics Pvt Ltd.
References

If you publish research with this product, please let us know so we can cite your paper.

Loading...