Human IL6 Receptor, RIL002
Recombinant human Interleukin-6 receptor (IL-6R) protein, produced from E. coli.
Interleukin 6 receptor (IL-6R) also known as CD126 (Cluster of Differentiation 126) is a type I cytokine receptor. The low concentration of a soluble form of IL-6 receptor (sIL-6R) acts as an agonist of IL-6 activity. In the IL-6R/CD126/IL6R system, both a membrane-bound IL-6R and a sIL- 6R protein are able to mediate IL-6 signals into the cells through the interaction of gp130. Recombinant Human Interleukin 6 receptor is used in several disease research area such as several chronic inflammatory and autoimmune diseases as well as in cancer.
Recombinant human Interleukin-6 receptor (IL-6R) protein, produced from E. coli.
Interleukin 6 receptor (IL-6R) also known as CD126 (Cluster of Differentiation 126) is a type I cytokine receptor. The low concentration of a soluble form of IL-6 receptor (sIL-6R) acts as an agonist of IL-6 activity. In the IL-6R/CD126/IL6R system, both a membrane-bound IL-6R and a sIL- 6R protein are able to mediate IL-6 signals into the cells through the interaction of gp130. Recombinant Human Interleukin 6 receptor is used in several disease research area such as several chronic inflammatory and autoimmune diseases as well as in cancer.
| Catalog Number | Product | DataSheet | Size | AVAILABILITY | Price | Qty |
|---|
Specifications
| Product Type: | Protein |
| Name: | Human IL6 Receptor |
| Accession ID: | P08887, A0N0L5 |
| Source: | Human Ð expressed in E. coli |
| Molecular Weight: | 37.2 kDa |
| Amino Acid Sequence: | GLVPRGSHMASPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPED NATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSC YRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTP SLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDS SFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNP RWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDL QHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPE |
| Fusion Tag(s): | C-terminus 6 _ His tag |
| Format: | Lyophilized; It is recommended to briefly spin the vial prior to opening to bring the contents to the bottom. Reconstitute lyophilized protein in sterile PBS |
| Purity: | >96 %, SDS-PAGE (Coomassie blue staining) |
| Buffer: | PBS |
| Activity: | Measured by its binding ability in a functional ELISA. Immobilized recombinant human IL-6R at 2ug/mL (100ul/well) can bind recombinant human IL6P with a linear range of 1.25- 20.0 ng/ml. |
| Comments: | Manufactured in an ISO 9001:20015 Certified Laboratory |
| Storage: | Store lyophilized human protein at +2C to +8 C, preferably desiccated. Upon reconstitution, prepare working aliquots and store at -20C. Avoid repeated freeze/thaw cycles. |
| Shipped: | Cold packs |
Documentation
Provider
From the laboratory at GeNext Genomics Pvt Ltd.
References
If you publish research with this product, please let us know so we can cite your paper.
