Human IL6 Protein, RIL001
Recombinant human Interleukin-6 (IL-6) protein, produced from E. coli.
Interleukin-6, originally identified as B-cell differentiation factor, is a multi-functional cytokine expressed by various cells having role in regulation of immune response, haematopoiesis, acute phase response and inflammation. IL-6 exerts its biological effect via IL-6 receptor and gp130. It binds with both membranous as well as soluble forms of IL-6 receptor to exhibit pleiotropic actions. Increased levels of this cytokine are associated with several inflammatory diseases such as Rheumatoid Arthritis. Interleukin-6 has been shown to inhibit the growth of early stage and to promote the proliferation of advanced stage melanoma cells in vitro.
Recombinant human Interleukin-6 (IL-6) protein, produced from E. coli.
Interleukin-6, originally identified as B-cell differentiation factor, is a multi-functional cytokine expressed by various cells having role in regulation of immune response, haematopoiesis, acute phase response and inflammation. IL-6 exerts its biological effect via IL-6 receptor and gp130. It binds with both membranous as well as soluble forms of IL-6 receptor to exhibit pleiotropic actions. Increased levels of this cytokine are associated with several inflammatory diseases such as Rheumatoid Arthritis. Interleukin-6 has been shown to inhibit the growth of early stage and to promote the proliferation of advanced stage melanoma cells in vitro.
| Catalog Number | Product | DataSheet | Size | AVAILABILITY | Price | Qty |
|---|
| Product Type: | Protein |
| Name: | Human IL6 Protein |
| Accession ID: | P05231, B5MCZ3 |
| Source: | Human Ð expressed in E. coli |
| Molecular Weight: | 17 kDa |
| Amino Acid Sequence: | FFYHMASGRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDG CFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTP DPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQMLEFFI |
| Fusion Tag(s): | C-terminus 6 _ His tag |
| Format: | Lyophilized powder. Dilute to 1 mg/mL in PBS |
| Purity: | >98 %, purified by Ni NTA and determined by SDS-PAGE. |
| Buffer: | PBS |
| Tested Applications: | Drug discovery, research, cell proliferation assays |
| Comments: | Manufactured in an ISO 9001:20015 Certified Laboratory |
| Storage: | Store at -20 degree C, for extended storage |
| Shipped: | Cold packs |
If you publish research with this product, please let us know so we can cite your paper.
