MarathonRT purified from Eubacterium rectale is an ultra-processive reverse transcriptase used to catalyze the formation of DNA from RNA.
Highlights:
Catalog Number | Product | DataSheet | Size | AVAILABILITY | Price | Qty |
---|
At the time of purchase, customers may be asked to provide validation of their non profit status. Please Contact Us with any questions.
Product Type: | Protein |
Name: | E. r. Group II intron reverse transcriptase |
Accession ID: | CBK92290.1 |
Source: | Eubacterium rectale |
Molecular Weight: | 49007.72 Da |
Amino Acid Sequence: | MDTSNLMEQILSSDNLNRAYLQVVRNKGAEGVDGMKYTELKEHLAKNGETIKGQLRTRKYKPQPARRVEIPKPDGGVRNLGVPTVTDRFIQQAIAQVLTPIYEEQFHDHSYGFRPNRCAQQAILTALNIMNDGNDWIVDIDLEKFFDTVNHDKLMTLIGRTIKDGDVISIVRKYLVSGIMIDDEYEDSIVGTPQGGNLSPLLANIMLNELDKEMEKRGLNFVRYADDCIIMVGSEMSANRVMRNISRFIEEKLGLKVNMTKSKVDRPSGLKYLGFGFYFDPRAHQFKAKPHAKSVAKFKKRMKELTCRSWGVSNSYKVEKLNQLIRGWINYFKIGSMKTLCKELDSRIRYRLRMCIWKQWKTPQNQEKNLVKLGIDRNTARRVAYTGKRIAYVCNKGAVNVAISNKRLASFGLISMLDYYIEKCVTC |
Purity: | >95% |
Buffer: | 25 mM K-HEPES pH 7.5, 300 mM KCl, 10% glycerol and 1 mM DTT |
Concentration: | 20 units/uL |
Activity: | By using poly(rA) as the template and dT18 as the primer, 1 unit is equal to the amount of MarathonRT that incorporates 1 nmole dTTP at 42C in 30 min. |
Comments: | An ultra-processive reverse transcriptase |
Storage: | -80C |
Shipped: | Dry ice |
If you publish research with this product, please let us know so we can cite your paper.