MarathonRT Reverse Transcriptase
MarathonRT purified from Eubacterium rectale is an ultra-processive reverse transcriptase used to catalyze the formation of DNA from RNA.
Highlights:
- Copies transcripts at least 10 kb in length and displays superior intrinsic RT processivity, compared to SSIV
- Low error frequency in single-molecule sequencing, comparable to that of other high-performance RTs, such as SSIV
From the laboratory of Anna Marie Pyle, PhD, Yale University.
MarathonRT purified from Eubacterium rectale is an ultra-processive reverse transcriptase used to catalyze the formation of DNA from RNA.
Highlights:
- Copies transcripts at least 10 kb in length and displays superior intrinsic RT processivity, compared to SSIV
- Low error frequency in single-molecule sequencing, comparable to that of other high-performance RTs, such as SSIV
From the laboratory of Anna Marie Pyle, PhD, Yale University.
| Catalog Number | Product | DataSheet | Size | AVAILABILITY | Price | Qty |
|---|
At the time of purchase, customers may be asked to provide validation of their non profit status. Please Contact Us with any questions.
Specifications
| Product Type: | Protein |
| Name: | E. r. Group II intron reverse transcriptase |
| Accession ID: | CBK92290.1 |
| Source: | Eubacterium rectale |
| Molecular Weight: | 49007.72 Da |
| Amino Acid Sequence: | MDTSNLMEQILSSDNLNRAYLQVVRNKGAEGVDGMKYTELKEHLAKNGETIKGQLRTRKYKPQPARRVEIPKPDGGVRNLGVPTVTDRFIQQAIAQVLTPIYEEQFHDHSYGFRPNRCAQQAILTALNIMNDGNDWIVDIDLEKFFDTVNHDKLMTLIGRTIKDGDVISIVRKYLVSGIMIDDEYEDSIVGTPQGGNLSPLLANIMLNELDKEMEKRGLNFVRYADDCIIMVGSEMSANRVMRNISRFIEEKLGLKVNMTKSKVDRPSGLKYLGFGFYFDPRAHQFKAKPHAKSVAKFKKRMKELTCRSWGVSNSYKVEKLNQLIRGWINYFKIGSMKTLCKELDSRIRYRLRMCIWKQWKTPQNQEKNLVKLGIDRNTARRVAYTGKRIAYVCNKGAVNVAISNKRLASFGLISMLDYYIEKCVTC |
| Purity: | >95% |
| Buffer: | 25 mM K-HEPES pH 7.5, 300 mM KCl, 10% glycerol and 1 mM DTT |
| Concentration: | 20 units/uL |
| Activity: | By using poly(rA) as the template and dT18 as the primer, 1 unit is equal to the amount of MarathonRT that incorporates 1 nmole dTTP at 42C in 30 min. |
| Comments: | An ultra-processive reverse transcriptase |
| Storage: | -80C |
| Shipped: | Dry ice |
Documentation
Provider
From the laboratory of Anna Marie Pyle, PhD, Yale University.
References
- Zhao C, Pyle AM. Crystal structures of a group II intron maturase reveal a missing link in spliceosome evolution. Nat Struct Mol Biol. 2016 Jun;23(6):558-65.
- Zhao C, Liu F, Pyle AM. An ultraprocessive, accurate reverse transcriptase encoded by a metazoan group II intron. RNA. 2018 Feb;24(2):183-195. doi: 10.1261/rna.063479.117. Epub 2017 Nov 6. PubMed PMID: 29109157; PubMed Central PMCID: PMC5769746.
- Scheepbouwer C, Aparicio-Puerta E, Gomez-Martin C, et al. ALL-tRNAseq enables robust tRNA profiling in tissue samples. Genes Dev. 2023;37(5-6):243-257. doi:10.1101/gad.350233.122
If you publish research with this product, please let us know so we can cite your paper.
