Azurin proteins with redox potentials that span the entire range of physiological redox potentials (from -950 mV to + 972 mV vs. standard hydrogen electrode) that can be used as tunable and water soluble redox agents for biochemical and biophysical studies.
Highlights:
Redox reactions are at the heart of numerous biological functions and chemical transformations, from electron transfer (ET) in photosynthesis and respiration to catalytic activations of C-H bonds and other molecules. The redox potential (E°) is one of the most important parameter in determining the efficiency of reactions. In contrast to a number of redox agents that are soluble in organic solvent, there are very few water-soluble/stable chemical redox agents within the physiological E°′ range. Even for those redox agents that can cover a wide range of E°′ in nonaqueous solutions, combining different redox agents with different scaffolds or surface properties makes it difficult to carry out systematic studies of the effect of E°′ on ET or catalytic functions, as it is difficult to deconvolute different factors in the redox process.
From the laboratory of Yi Lu, PhD, University of Illinois at Urbana-Champaign.
Catalog Number | Product | DataSheet | Size | AVAILABILITY | Price | Qty |
---|
Product Type: | Protein |
Name: | Azurin (Az) |
Accession ID: | UniProt: B3EWN9; PDB ID: 4AZU |
Source: | Expressed and purified from E. coli |
Molecular Weight: | 13,886 kDa |
Amino Acid Sequence: | AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMSFCTFPGHSALMKGTLTLK |
Fusion Tag(s): | None |
Purity: | >95% |
Buffer: | Usually ammonium acetate |
Concentration: | Varies by protein (0.01-5 mM); see individual product label for details |
Activity: | Redox agents with wide range of potentials |
Suggested Amount per Experiment: | Depends on experiment. Usually few µL of 0.1 mM |
Comments: | Contains a Cu- or Ni-binding site |
Storage: | -80C, Can be kept at 4C if used within a month |
Shipped: | Dry ice |
If you publish research with this product, please let us know so we can cite your paper.