Redox Potential-Tuned Azurin Proteins

Azurin proteins with redox potentials that span the entire range of physiological redox potentials (from -950 mV to + 972 mV vs. standard hydrogen electrode) that can be used as tunable and water soluble redox agents for biochemical and biophysical studies.

Highlights:

  • Highly pure, Pseudomonas aeruginosa azurin expressed in and purified from Escherichia coli
  • Display a wide range of reduction potentials from -954 to +972 mV (+/-10 mV) vs. SHE (the variants with negative reduction potentials are not stable in their reductive form)
  • Water soluble and relatively stable in organic solvents
  • Possess same overall structure and surface properties of native azurin and contain either a Cu center (as in azurin) or Ni in the place of the Cu center

Redox reactions are at the heart of numerous biological functions and chemical transformations, from electron transfer (ET) in photosynthesis and respiration to catalytic activations of C-H bonds and other molecules. The redox potential (E°) is one of the most important parameter in determining the efficiency of reactions. In contrast to a number of redox agents that are soluble in organic solvent, there are very few water-soluble/stable chemical redox agents within the physiological E°′ range. Even for those redox agents that can cover a wide range of E°′ in nonaqueous solutions, combining different redox agents with different scaffolds or surface properties makes it difficult to carry out systematic studies of the effect of E°′ on ET or catalytic functions, as it is difficult to deconvolute different factors in the redox process.

From the laboratory of Yi Lu, PhD, University of Illinois at Urbana-Champaign.

Catalog Number Product DataSheet Size AVAILABILITY Price Qty
EUI012
Azurin Protein (CuAz 494 mV), 100ug
100ug In stock
Regular Price:$281.00
On Sale:
EUI013
Azurin Protein (CuAz 551 mV), 100ug
100ug In stock
Regular Price:$281.00
On Sale:
EUI014
Azurin Protein (CuAz 640 mV), 100ug
100ug In stock
Regular Price:$281.00
On Sale:
EUI015
Azurin Protein (NiAz -450 mV), 100ug
100ug In stock
Regular Price:$281.00
On Sale:
EUI016
Azurin Protein (NiAz -950 mV), 100ug
100ug Currently Unavailable
Regular Price:$281.00
On Sale:
EUI017
Azurin Protein Sample Pack, 50ug of each
50ug of each In stock
Regular Price:$1,127.00
On Sale:
EUI008
Azurin Protein (CuAz 90 mV), 100ug
100ug In stock
Regular Price:$281.00
On Sale:
EUI009
Azurin Protein (CuAz 171 mV), 100ug
100ug In stock
Regular Price:$281.00
On Sale:
EUI010
Azurin Protein (CuAz 265 mV), 100ug
100ug In stock
Regular Price:$281.00
On Sale:
EUI011
Azurin Protein (CuAz 396 mV), 100ug
100ug In stock
Regular Price:$281.00
On Sale:
Specifications

Product Type: Protein
Name: Azurin (Az)
Accession ID: B3EWN9
Source: Expressed and purified from E. coli
Molecular Weight: 13,886 kDa
Amino Acid Sequence: AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMSFCTFPGHSALMKGTLTLK
Fusion Tag(s): None
Purity: >95%
Buffer: Usually ammonium acetate
Concentration: Varies by protein (0.01-5 mM); see individual product label for details
Activity: Redox agents with wide range of potentials
Suggested Amount per Experiment: Depends on experiment. Usually few µL of 0.1 mM
Comments: Contains a Cu- or Ni-binding site
Storage: -80C, Can be kept at 4C if used within a month
Shipped: Dry ice

Provider
From the laboratory of Yi Lu, PhD, University of Illinois at Urbana-Champaign.
References
  1. Hosseinzadeh P, Marshall NM, Chacón KN, Yu Y, Nilges MJ, New SY, Tashkov SA, Blackburn NJ, Lu Y. Design of a single protein that spans the entire 2-V range of physiological redox potentials. Proc Natl Acad Sci U S A. 2016 Jan 12;113(2):262-7.
  2. Marshall NM, Garner DK, Wilson TD, Gao YG, Robinson H, Nilges MJ, Lu Y. Rationally tuning the reduction potential of a single cupredoxin beyond the natural range. Nature. 2009 Nov 5;462(7269):113-6.

If you publish research with this product, please let us know so we can cite your paper.

Loading...