Biotinylated-Trx Loading Control Protein

This biotinylated bacterial protein can be used as a procedural control for affinity capture experiments using avidin or streptavidin beads and biotinylated proteins.

Highlights:

  • Reliable procedural and loading control for biotin-based affinity experiments
  • Small (~12 kDa) size - Easily detected via Western blot using commercially avaliable anti-E. coli Trx antibodies
  • Compatible with all biotin-based cysteine oxidation probes

Avidin and streptavidin are widely used in biotechnology and molecular research for detection, purification, crosslinking, and labeling of biotinylated targets. This protein can be used in a manner similar to the way prebiotinylated AhpC was used in experiments with DCP-Bio1 (discussed in Klomsiri et al., Methods Enzymol, 2010).

From the laboratory of Leslie B. Poole, PhD, Wake Forest School of Medicine.

The Investigator's Annexe Part of The Investigator's Annexe program.

Catalog Number Product Size AVAILABILITY Price Qty
EE0034
Biotinylated-Trx Loading Control Protein, 50ug
50ug (1mg/mL) In stock
Regular Price:$204.00
EE0035
Biotinylated-Trx Loading Control Protein, 250ug
250ug (1mg/mL) In stock
Regular Price:$614.00
Specifications

Product Type: Protein
Name: Biotinylated-Trx Loading Control Protein
Accession ID: P0AA25 (THIO_ECOLI)
Source: Recombinantly expressed in E.Coli and modified with biotin-maleimide
Molecular Weight: 11,675 + 903 Da (2 biotin molecules)
Amino Acid Sequence: SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA
Fusion Tag(s): None
Purity: 95% as determined by SDS-PAGE
Buffer: 25mM potassium phosphate pH 7, 1mM EDTA
Concentration: 1mg/mL
Suggested Amount per Experiment: 1 microgram per 1000 micrograms of sample
Comments: Has 2 biotin-maleimide moieties attached at Cys residues
Storage: -20C (avoid repeated freeze-thaw cycles)
Shipped: Cold packs

Provider
From the laboratory of Leslie B. Poole, PhD, Wake Forest School of Medicine.
References
  1. Klomsiri, C., Nelson, K.J., Bechtold, E., Soito, L., Johnson, L.C., Lowther, W.T., Ryu, S.E., King, S.B., Furdui, C.M. & Poole, L.B. Use of dimedone-based chemical probes for sulfenic acid detection: evaluation of conditions affecting probe incorporation into redox-sensitive proteins. Methods Enzymol 473, 77-94 (2010). PMC3795394

If you publish research with this product, please let us know so we can cite your paper.

Loading...