This human GH is over-expressed and purified from E. coli.
Human growth hormone (GH), also known as somatotropin, is synthesized in the anterior pituitary as a 217-amino acid precursor, which is further cleaved to generate the mature 191-amino acid (22 kDa) cytokine. Through binding to the GH receptor, it exhibits potent pleiotropic biological effects in an IGF1-dependent and -independent manner. Prominent signal transduction events activated by GH include the JAK/STAT and MAPK/ERK pathways, culminating in IGF1 production and growth promotion. Other significant effects of GH are activation of lipolysis, stimulation of protein synthesis, and augmentation of immune function. Since this function of GH is generally anabolic, it has been explored clinically to treat short stature in children. Bovine GH is used to increase milk production in dairy cows. Human and bovine GH amino acid sequences are 67% homologous, rendering the effects of GH species-specific.
From the laboratory of Te-Chung Lee, PhD, University at Buffalo.
Part of The Investigator's Annexe program.
Catalog Number | Product | DataSheet | Size | AVAILABILITY | Price | Qty |
---|
Product Type: | Protein |
Name: | Human Growth Hormone (hGH) |
Accession ID: | K02382.1 |
Source: | Recombinant, purified from E. coliBL21 |
Molecular Weight: | 22 kDa |
Amino Acid Sequence: | MFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF |
Fusion Tag(s): | None |
Purity: | 99% |
Buffer: | HBSS |
Concentration: | 0.1mg/mL |
Storage: | Store at -80C |
Shipped: | Dry ice |
hGH Activity Analysis
Human GH activity as assessed by its ability to stimulate the proliferation of HL-1 cardiomyocytes in vitro. Cells were treated with GH at the concentrations indicated in the absence of serum. MTT assay was performed three days after the treatment. Higher concentrations of GH were found to be less effective in promoting HL-1 proliferation.
If you publish research with this product, please let us know so we can cite your paper.