Isocitrate Dehydrogenase 1 (IDH1), (R132H)

This recombinant full-length human isocitrate dehydrogenase (IDH1) variant was produced in E. coli and contains an Arg to His substitution at residue 132 (R132H).

Isocitrate dehydrogenases (IDH) catalyzes the oxidative decarboxylation of isocitrate, producing alpha-ketoglutarate and CO2. Specific mutations in the isocitrate dehydrogenase gene isocitrate dehydrogenase 1 (IDH1) have been found in several brain tumors including astrocytoma, oligodendroglioma and glioblastoma multiforme, with mutations found in nearly all cases of secondary glioblastomas. Specifically, mutations at Arg 132 have been shown to result in a new ability of the enzyme to catalyze the NADPH-dependent reduction of alpha-ketoglutarate to R(-)-2-hydroxyglutarate (2HG). Excess accumulation of 2HG has been shown to lead to an elevated risk of malignant brain tumors in patients with inborn errors of 2HG metabolism.

Catalog Number Product Size AVAILABILITY Price Qty
FS1003
Isocitrate Dehydrogenase 1 (IDH1), (R132H), 20ug
20ug (5.76mg/mL) In stock
Price: $199.00
FS1004
Isocitrate Dehydrogenase 1 (IDH1), (R132H), 100ug
100ug (5.76mg/mL) In stock
Price: $746.00
Specifications
Product Type: Protein
Name: Isocitrate Dehydrogenase 1 (IDH1)-(R132H variant)-8xHis
Source: Human protein expressed in E.Coli Rosetta (DE3)
Molecular Weight: 48,067 Da
Amino Acid Sequence: MSKKISGGSVVEMQGDEMTRIIWELIKEKLIFPYVELDLHSYDLGIENRDATNDQVTKDAAEAIKKHNVGVKCATITPDEKRVEEFKLKQMWKSPNGTIRNILGGTVFREAIICKNIPRLVSGWVKPIIIG(R>H)CHAYGDQYRATDFVVPGPGKVEITYTPSDGTQKVTYLVHNFEEGGGVAMGMYNQDKSIEDFAHSSFQMALSKGWPLYLSTKNTILKKYDGRFKDIFQEIYDKQYKSQFEAQKIWYEHRLIDDMVAQAMKSEGGFIWACKNYDGDVQSDSVAQGYGSLGMMTSVLVCPDGKTVEAEAAHGTVTRHYRMYQKGQETSTNPIASIFAWTRGLAHRAKLDNNKELAFFANALEEVSIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKIKLAQAKSLEHHHHHHHH
Fusion Tag(s): Contains C-terminal 8xHis tag
Purity: >98% as determined by SDS-PAGE
Buffer: 50 mM Tris-HCl, pH 7.5, 150 mM NaCl, 5 mM BME, 10% glycerol
Storage: -80C
Shipped: Dry ice
Documentation

Additional Information

Theoretical pI: 6.53
Extinction coefficient: 63830
A280: 1.328

Data

SDS-PAGE Analysis

References
  1. Dang, L. et al. Cancer associated IDH1 mutations produce 2-hydroxyglutarate. Nature 462, 739-744 (2009).

If you publish research with this product, please let us know so we can cite your paper.

 
Loading...
Loading...