Human Fibronectin III 1C C-His

This recombinant fragment is modeled after the C-terminal two-thirds of the type-III 1 (amino acids N600-P674), which binds to FN and enhances FN self association. Treatment of purified FN in solution with the type-III 1-C fragment resulted in the appearance of multimers of FN.

Fibronectins (FN) are a family of high molecular weight, multidomain glycoproteins composed of two structurally similar subunits which are joined at the carboxyl terminus by disulfide bonds. The primary structure of FN is organized into three types of repeating homologous units, termed types I, II, and III. These modules in turn are organized into functional domains which have been shown to contain multiple binding sites, including those for sulfated glycosaminoglycans, gelatin, fibrin, and cell surface integrin receptors. Twelve type I modules are found grouped at the amino- and carboxyl-terminal regions, and two type II modules are located within the gelatin-binding region. Fifteen to seventeen type III modules are contained within the middle of the molecule and comprise 60% of fibronectin’s sequence.

The first type-III repeat in FN has been shown to play an important role in FN matrix assembly and FN-FN binding (self association).

From the laboratory of Denise C. Hocking, PhD, University of Rochester Medical Center.

The Investigator's AnnexePart of The Investigator's Annexe program.

Catalog Number Product DataSheet Size AVAILABILITY Price Qty
EUR101
Human Fibronectin III 1C C-His
250ug In stock
Regular Price:$151.00
On Sale:
Specifications

Product Type: Protein
Name: Recombinant Human Fibronectin III 1; amino acids N600-P674
Accession ID: Q9H6D8, Q5VTL7, Q8TC99, Q8BJN4
Source: Human protein expressed in E. coliDH5 alpha carrying the cloned gene in pQE12
Molecular Weight: 10155.3 Da
Amino Acid Sequence: MRGSNAPQPSHISKYILRWRPKNSVGRWKEATIPGHLNSYTIKGLKPGVVYEGQLISIQQYGHQEVTRFDFTTTSTSTPGSRSHHHHHH
Fusion Tag(s): 6-His, C-terminal
Purity: > 95% by SDS-PAGE
Buffer: Solution in PBS
Concentration: 0.9mg/mL
Storage: Store at -80C
Shipped: Dry ice

Provider
From the laboratory of Denise C. Hocking, PhD, University of Rochester Medical Center.
Comments

Human fibronectin III subunit 1 with C-terminal His tag

Schematic representation of a fibronectin subunit and recombinant fibronectin fusion protein.
References
  1. Morla, A., Zhang, Z., and Ruoslahti, E. (1994) Superfibronectin is a functionally distinct form of fibronectin. Nature 367:193-196.

If you publish research with this product, please let us know so we can cite your paper.

Loading...