Human Epidermal Growth Factor (EGF)-GST Protein

This recombinant human EGF is expressed as a GST-fusion protein, which allows for easy detection via western blot. The fusion junction of the protein harbors an engineered thrombin cleavage site and a protein kinase A (PKA) phosphorylation site. The GST portion of the fusion protein can be cleaved off by thrombin if necessary. The fusion protein can also be radioactively labeled with 32P-r-ATP and PKA.

Epidermal growth factor (EGF) is the founding member of the EGF family of mitogens possessing potent biological activities on numerous cell types. Other notable members of the family include HB-EGF, TGF-alpha, and four neuregulin isoforms. Human EGF is synthesized as a large precursor (1,208 amino acids), which is cleaved to generate the mature form containing 53 amino acids with three intramolecular disulfide linkages mediated by six highly conserved cysteine residues. The mature EGF peptide binds with high affinity to EGF receptor (ErbB) and elicits a signaling cascade, ultimately promoting DNA replication and cell proliferation. While insufficient ErbB signaling can cause degenerative diseases, excessive receptor activation is associated with oncogenic development.

From the laboratory of Te-Chung Lee, PhD, University at Buffalo.

The Investigator's Annexe Part of The Investigator's Annexe program.

Catalog Number Product DataSheet Size AVAILABILITY Price Qty
EBU003
Human Epidermal Growth Factor (EGF)-GST Protein, 250ug
250ug (0.1mg/mL) In stock
Regular Price:$323.00
On Sale:
EBU004
Human Epidermal Growth Factor (EGF)-GST Protein, 1mg
1mg, 4x250ug (0.1mg/mL) In stock
Regular Price:$904.00
On Sale:
Specifications

Product Type: Protein
Name: Human Epidermal Growth Factor (EGF)-GST
Accession ID: AAS83395
Source: Recombinant, purified from E. coliBL21
Molecular Weight: 6.2kDa (~32 kDa with GST)
Amino Acid Sequence: NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR
Fusion Tag(s): GST
Purity: 99%
Buffer: PBS
Concentration: 0.1mg/mL
Storage: Store at -80C
Shipped: Dry ice

Data

EGF Activity Analysis

YY1 Protein

EGF activity assessed by its ability to stimulate the proliferation of HeLa cells in the absence of fetal bovine serum. Cells were treated with GST-EGF at the concentrations indicated, and MTT assay was performed 3 days after treatment.

Provider
From the laboratory of Te-Chung Lee, PhD, University at Buffalo.
References

If you publish research with this product, please let us know so we can cite your paper.

Loading...