LR3-Insulin Like Growth Factor 1 (IGF-1)

LR3 insulin-like growth factor-1 (IGF-I) is a recombinant analog of human IGF-I containing the complete human IGF-I protein sequence with substitution of Arg for Glu3 and a 13 amino acid N-terminal extension peptide.

Insulin-like growth factor 1 (IGF-1), also known as somatomedin C, is a protein similar in structure to insulin. IGF-1 is a primary mediator of the effects of growth hormone (GH). IGF-1 then stimulates systemic body growth, and has growth-promoting effects on almost every cell in the body, especially skeletal muscle, cartilage, bone, liver, kidney, nerve, skin, hematopoietic, and lung cells. In addition to the insulin-like effects, IGF-1 can also regulate cellular DNA synthesis.

Catalog Number Product Size AVAILABILITY Price Qty
FNB001
LR3 Insulin-Like Growth Factor-1, 1mg
1mg 1-2 weeks
Price: $110.00
FNB002
LR3 Insulin-Like Growth Factor-1, 100mg
10mg 1-2 weeks
Price: $825.00
FNB003
LR3 Insulin-Like Growth Factor-1, 500mg
500mg 1-2 weeks
Price: $1,925.00
Specifications
Product Type: Protein
Source: E. Coli, BL21 or Rosetta
Molecular Weight: 9.1-9.2KD (depended on bacterial strains (BL21 or Rosetta strains)
Amino Acid Sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Fusion Tag(s): None
Purity: > 95% in SDS PAGE or >98% RP-HPLC
Buffer: 5mM Acetic Acid
Concentration: 1mg/mL
Activity: 1X105
Comments: 13 leading bovine insulin sequence as long arm for the IGF to enhance the activity and longer half like.
Storage: Liquid form below 4C for 2 Week, Powder form below 4C for Long term
Shipped: Cold Packs
References

If you publish research with this product, please let us know so we can cite your paper.

 
Loading...
Loading...