MarathonRT Reverse Transcriptase

MarathonRT purified from Eubacterium rectale is an ultra-processive reverse transcriptase used to catalyze the formation of DNA from RNA.

Highlights:

  • Copies transcripts at least 10 kb in length and displays superior intrinsic RT processivity, compared to SSIV
  • Low error frequency in single-molecule sequencing, comparable to that of other high-performance RTs, such as SSIV
  • From the laboratory of Anna Marie Pyle, PhD, Yale University.

Catalog Number Product Size AVAILABILITY Price Qty
EYU007
MarathonRT Reverse Transcriptase, 20uL (20 units/uL)
20uL (20 units/uL) In stock
Price: $130.00
Specifications
Product Type: Peptide
Name: E. r. Group II intron reverse transcriptase
Accession ID: CBK92290.1
Source: Eubacterium rectale
Molecular Weight: 49007.72 Da
Amino Acid Sequence: MDTSNLMEQILSSDNLNRAYLQVVRNKGAEGVDGMKYTELKEHLAKNGETIKGQLRTRKYKPQPARRVEIPKPDGGVRNLGVPTVTDRFIQQAIAQVLTPIYEEQFHDHSYGFRPNRCAQQAILTALNIMNDGNDWIVDIDLEKFFDTVNHDKLMTLIGRTIKDGDVISIVRKYLVSGIMIDDEYEDSIVGTPQGGNLSPLLANIMLNELDKEMEKRGLNFVRYADDCIIMVGSEMSANRVMRNISRFIEEKLGLKVNMTKSKVDRPSGLKYLGFGFYFDPRAHQFKAKPHAKSVAKFKKRMKELTCRSWGVSNSYKVEKLNQLIRGWINYFKIGSMKTLCKELDSRIRYRLRMCIWKQWKTPQNQEKNLVKLGIDRNTARRVAYTGKRIAYVCNKGAVNVAISNKRLASFGLISMLDYYIEKCVTC
Purity: >95%
Buffer: 25 mM K-HEPES pH 7.5, 300 mM KCl, 10% glycerol and 1 mM DTT
Concentration: 20 units/uL
Activity: By using poly(rA) as the template and dT18 as the primer, 1 unit is equal to the amount of MarathonRT that incorporates 1 nmole dTTP at 42C in 30 min.
Comments: An ultra-processive reverse transcriptase
Storage: -80C
Shipped: Dry ice
Provider
From the laboratory of Anna Marie Pyle, PhD, Yale University.
References
  1. Zhao C, Pyle AM. Crystal structures of a group II intron maturase reveal a missing link in spliceosome evolution. Nat Struct Mol Biol. 2016 Jun;23(6):558-65.
  2. Zhao C, Liu F, Pyle AM. An ultraprocessive, accurate reverse transcriptase encoded by a metazoan group II intron. RNA. 2018 Feb;24(2):183-195. doi: 10.1261/rna.063479.117. Epub 2017 Nov 6. PubMed PMID: 29109157; PubMed Central PMCID: PMC5769746.

If you publish research with this product, please let us know so we can cite your paper.

 
Loading...
Loading...