Anti-Ferroportin (SLC40A1) Antibody
This rabbit polyclonal antibody was generated against GST-fusion protein containing 4 tandem copies of the C-terminal 32 amino acid domain of mouse ferroportin (FPN) and is specific for mouse FPN .
Highlights:
- Reacts with mouse FPN
- Binds to the epitope RFAQKTLGNQIFVCGPDEKEVTDENQPNTSVV
- Suitable for Western Blot and Immunohistochemistry applications
Ferroportin also known as solute carrier family 40 member 1 (SLC40A1) is a transmembrane protein that transports iron from the inside of a cell to the outside of the cell. It also plays a role in transferring iron between maternal and fetal circulation. The protein mediates iron efflux in the presence of a ferroxidase (hephaestin and/or ceruloplasmin).
From the laboratory of Kostas Pantopoulos, PhD, McGill University.
This rabbit polyclonal antibody was generated against GST-fusion protein containing 4 tandem copies of the C-terminal 32 amino acid domain of mouse ferroportin (FPN) and is specific for mouse FPN .
Highlights:
- Reacts with mouse FPN
- Binds to the epitope RFAQKTLGNQIFVCGPDEKEVTDENQPNTSVV
- Suitable for Western Blot and Immunohistochemistry applications
Ferroportin also known as solute carrier family 40 member 1 (SLC40A1) is a transmembrane protein that transports iron from the inside of a cell to the outside of the cell. It also plays a role in transferring iron between maternal and fetal circulation. The protein mediates iron efflux in the presence of a ferroxidase (hephaestin and/or ceruloplasmin).
From the laboratory of Kostas Pantopoulos, PhD, McGill University.
Specifications
| Product Type: | Antibody |
| Antigen: | Mouse FPN |
| Accession ID: | Q9NP59 |
| Molecular Weight: | 63 kDa |
| Clonality: | Polyclonal |
| Reactivity: | Mouse |
| Immunogen: | GST-fusion protein containing 4 tandem copies of the C-terminal 32 amino acid domain of mouse Fpn |
| Species Immunized: | Rabbit |
| Epitope: | RFAQKTLGNQIFVCGPDEKEVTDENQPNTSVV |
| Purification Method: | To remove antibodies that were generated against the GST moiety, serum was purified by absorption through an affinity column of immobilized GST (Pierce) |
| Buffer: | Serum with 0.05% sodium azide |
| Tested Applications: | WB (1:1000), IHC (1:500) |
| Storage: | -80C |
| Shipped: | Cold Packs (Domestic, Overnight); Dry Ice (International) |
Provider
From the laboratory of Kostas Pantopoulos, PhD, McGill University.
References
- Schümann K, Herbach N, Kerling C, Seifert M, Fillebeen C, Prysch I, Reich J, Weiss G, Pantopoulos K. Iron absorption and distribution in TNF(DeltaARE/+) mice, a model of chronic inflammation. J Trace Elem Med Biol. 2010 Jan;24(1):58-66.
- Wilkinson N, Pantopoulos K. IRP1 regulates erythropoiesis and systemic iron homeostasis by controlling HIF2? mRNA translation. Blood. 2013 Aug 29;122(9):1658-68.
If you publish research with this product, please let us know so we can cite your paper.
