Anti-Zika Virus Envelope (E) Protein, ED3 Domain [3E10D1] Antibody
![Anti-Zika Virus Envelope (E) Protein, ED3 Domain [3E10D1] Antibody](https://www.kerafast.com/MediaStorage/Product/Images/Large/1411_2001202001264614100.jpg "Anti-Zika Virus Envelope (E) Protein, ED3 Domain [3E10D1] Antibody")
This mouse monoclonal antibody was generated against the ED3 domain of the Zika virus E protein, and recognizes ZIKV E protein, ED3 domain .
Highlights:
- Recognizes Zika virus E protein
- Specific for the ED3 domain of ZIKV E protein
- Suitable for Immunofluorescence and Western Blot applications
Zika virus (ZIKV) is a member of the virus family Flaviviridae and the genus Flavivirus, transmitted by daytime-active Aedes mosquitoes. Zika is related to other mosquito transmitted viruses such as dengue, yellow fever, Japanese encephalitis and West Nile. Similar to other flaviviruses, ZIKV is enveloped and icosahedral and has a nonsegmented, single-stranded, positive-sense RNA genome. Common symptoms of infection with the virus include mild headaches, maculopapular rash, fever, malaise, conjunctivitis, and joint pains.
From the laboratory of Donghoon Chung, PhD, University of Louisville.
This mouse monoclonal antibody was generated against the ED3 domain of the Zika virus E protein, and recognizes ZIKV E protein, ED3 domain .
Highlights:
- Recognizes Zika virus E protein
- Specific for the ED3 domain of ZIKV E protein
- Suitable for Immunofluorescence and Western Blot applications
Zika virus (ZIKV) is a member of the virus family Flaviviridae and the genus Flavivirus, transmitted by daytime-active Aedes mosquitoes. Zika is related to other mosquito transmitted viruses such as dengue, yellow fever, Japanese encephalitis and West Nile. Similar to other flaviviruses, ZIKV is enveloped and icosahedral and has a nonsegmented, single-stranded, positive-sense RNA genome. Common symptoms of infection with the virus include mild headaches, maculopapular rash, fever, malaise, conjunctivitis, and joint pains.
From the laboratory of Donghoon Chung, PhD, University of Louisville.
| Product Type: | Antibody |
| Antigen: | Zika virus ED3 |
| Accession ID: | A0A142I5B9, A0A1C8L488 |
| Molecular Weight: | 12.1 kDa |
| Isotype: | IgG2b,k |
| Clonality: | Monoclonal |
| Clone Name: | 3E10D1 |
| Reactivity: | Zika virus |
| Immunogen: | Bacterial expressed ED3 (dklrlkgvsyslctaaftftkipaetlhgtvtvevqyagtdgpckvpaqmavdmqtltpvgrlitanpvitestenskmmleldppfgdsyivigvgekkithhwhrsgsti) |
| Species Immunized: | Mouse |
| Epitope: | Zika ED3 |
| Purification Method: | Protein G |
| Tested Applications: | IF (1: 2000); showed suitability for WB and IFA (1µg/ml for WB and 0.1-10µg/mL for IFA) |
| Storage: | -20C |
| Shipped: | Cold packs |
If you publish research with this product, please let us know so we can cite your paper.
