Guinea pig L-Asparaginase

Recombinant full length (aa 1-565) guinea pig L-asparginase purified by nickel-sepharose chromatography.

Highlights:

  • Highly pure - >99% (SDS-PAGE)
  • High L-asparaginase activity with low KM (~50 µM) for Asn
  • Very low L-glutaminase activity

Asparaginase (EC 3.5.1.1, USAN) or Colaspase (BAN) is an enzyme that catalyzes the hydrolysis of asparagine (Asn) to aspartic acid. Asparagine has been shown to be essential for protein synthesis by some tumur cells which are unable to synthesize asparagine.

From the laboratory of Arnon Lavie, PhD, University of Illinois at Chicago.

The Investigator's Annexe Part of The Investigator's Annexe program.

Catalog Number Product Size AVAILABILITY Price Qty
EB0020-FP
Guinea pig L-Asparaginase, 100ug
100ug In stock
Price: $269.00
EB0021-FP
Guinea pig L-Asparaginase, 1mg
1mg In stock
Price: $2,153.00

This product is for sale to Nonprofit customers only. For profit customers, please Contact Us for more information.

Specifications
Product Type: Protein
Name: Guinea pig L-asparaginase
Accession ID: H0W0T5
Source: Recombinant expression in E. coli
Molecular Weight: ~63 kDa
Amino Acid Sequence: MARASGSERHLLLIYTGGTLGMQSKGGVLVPGPGLVTLLRTLPMFHDKEFAQAQGLPDHALALPPASHGPRVLYTVLECQPLLDSSDMTIDDWIRIAKIIERHYEQYQGFVVIHGTDTMASGASMLSFMLENLHKPVILTGAQVPIRVLWNDARENLLGALLVAGQYIIPEVCLFMNSQLFRGNRVTKVDSQKFEAFCSPNLSPLATVGADVTIAWDLVRKVKWKDPLVVHSNMEHDVALLRLYPGIPASLVRAF
Fusion Tag(s): N-terminal His tag
Purity: >99% (SDS-PAGE)
Buffer: 25 mM Tris pH7.5, 500 mM NaCl, 2 mM DTT, 1 mM EDTA
Concentration: 4.4mg/mL
Activity: 1,400 IU/mg protein; kcat= 24.5/sec with Asn as substrate; One unit of guinea pig L-asparaginase converts 1.0 µmole of Asn to Asp per minute at pH 7.5 at 37°C, as measured by a coupled enzyme system with 2 mM Asn as substrate.
Storage: -80C
Shipped: Dry ice
Data

SDS-PAGE Analysis

Provider
From the laboratory of Arnon Lavie, PhD, University of Illinois at Chicago.
References
  1. Schalk AM, Nguyen HA, Rigouin C, Lavie A. Identification and structural analysis of an L-asparaginase enzyme from guinea pig with putative tumor cell killing properties. J Biol Chem. 2014 Nov 28;289(48):33175-86. doi: 10.1074/jbc.M114.609552. Epub 2014 Oct 15.

If you publish research with this product, please let us know so we can cite your paper.

 
Loading...
Loading...