Ferredoxin [4Fe-4S]
![Ferredoxin [4Fe-4S]](https://www.kerafast.com/MediaStorage/Product/Images/Large/838_200120200126238370.jpg "Ferredoxin [4Fe-4S]")
This Pyrococcus furiosus Ferredoxin contains a single low potential [4Fe-4S] cluster. It is used to donate to and accept electrons from a variety of oxidoreductase-type enzymes.
Highlights:
- Purity of >90%
- Highly thermostable - active over broad range (up to 100°C)
- Can be used as an electron donor/acceptor with various oxidoreductase-type enzymes
Ferredoxins are iron-sulfur proteins that mediate electron transfer in a range of metabolic reactions. The iron-sulfur clusters of ferredoxins can accept or discharge electrons, the effect being change in the oxidation states (+2 or +3) of the iron atoms. In this way, ferredoxin acts as electron transfer agents in biological redox reactions.
From the laboratory of Michael W. W. Adams, PhD, University of Georgia.
This Pyrococcus furiosus Ferredoxin contains a single low potential [4Fe-4S] cluster. It is used to donate to and accept electrons from a variety of oxidoreductase-type enzymes.
Highlights:
- Purity of >90%
- Highly thermostable - active over broad range (up to 100°C)
- Can be used as an electron donor/acceptor with various oxidoreductase-type enzymes
Ferredoxins are iron-sulfur proteins that mediate electron transfer in a range of metabolic reactions. The iron-sulfur clusters of ferredoxins can accept or discharge electrons, the effect being change in the oxidation states (+2 or +3) of the iron atoms. In this way, ferredoxin acts as electron transfer agents in biological redox reactions.
From the laboratory of Michael W. W. Adams, PhD, University of Georgia.
Specifications
| Product Type: | Protein |
| Name: | Ferredoxin (single [4Fe-4S] clusters) |
| Accession ID: | PF1909, NP_579638.1 |
| Source: | Pyrococcus furiosus |
| Molecular Weight: | 7.2 kDa |
| Amino Acid Sequence: | MAWKVSVDQDTCIGDAICASLCPDVFEMNDEGKAQPKVEVIEDEELYNCAKEAMEACPVSAITIEEA |
| Fusion Tag(s): | None |
| Purity: | >90% |
| Buffer: | 50 mM Tris, 200 mM NaCl, pH 8.0 |
| Concentration: | 5.6mg/mL |
| Suggested Amount per Experiment: | 10ug per assay |
| Comments: | Single low potential [4Fe-4S] cluster |
| Storage: | Frozen at -20°C or below, but stable at room temperature |
| Shipped: | Ambient temperature |
Provider
From the laboratory of Michael W. W. Adams, PhD, University of Georgia.
References
- Kim C, Brereton PS, Verhagen MF, Adams MW. Ferredoxin from Pyrococcus furiosus. Methods Enzymol. 2001;334:30-40. doi:10.1016/s0076-6879(01)34455-5
If you publish research with this product, please let us know so we can cite your paper.
