Recombinant Human Insulin
This human insulin was produced by DNA recombinant technology using the yeast, Pichia pastoris, and is present in its final processed form.
Highlights:
- Highly Pure (>99%) – produced using proprietary chromatographic purification techniques
- Endotoxin free – ideal for cell culture and in vivo studies
- Lyophilized form – allows for easy reconstitution in dilute acids and alkalis
Insulin exerts effects on glucose metabolism by binding to Insulin receptors throughout the body. Upon binding, Insulin promotes the cellular uptake of glucose into fat and skeletal muscle and inhibits hepatic glucose output, thus lowering the blood glucose.
This human insulin was produced by DNA recombinant technology using the yeast, Pichia pastoris, and is present in its final processed form.
Highlights:
- Highly Pure (>99%) – produced using proprietary chromatographic purification techniques
- Endotoxin free – ideal for cell culture and in vivo studies
- Lyophilized form – allows for easy reconstitution in dilute acids and alkalis
Insulin exerts effects on glucose metabolism by binding to Insulin receptors throughout the body. Upon binding, Insulin promotes the cellular uptake of glucose into fat and skeletal muscle and inhibits hepatic glucose output, thus lowering the blood glucose.
| Catalog Number | Product | DataSheet | Size | AVAILABILITY | Price | Qty |
|---|
Specifications
| Product Type: | Protein |
| Name: | Human Insulin |
| Accession ID: | P01308 |
| Source: | Pichia pastoris |
| Molecular Weight: | 5.808 kDa |
| Amino Acid Sequence: |
Chain A: GIVEQCCTSICSLYQLENYCN Chain B: FVNQHLCGSHLVEALYLVCGERGFFYTPKT |
| Fusion Tag(s): | None |
| Format: | Lyophilized powder |
| Purity: | 99.4% by HPLC |
| Solubility: | Soluble in solutions of dilute acids and alkalis. Insoluble in water and ethanol. |
| Activity: | 28.6 units/mg |
| Storage: | -20C, protected from light |
| Shipped: | Cold packs |
Comments
The composition of this human insulin is in its final processed form (two chains (A and B) linked by disulfide bonds).
Certificate of analysis avaliable upon request.
References
- Niroula J, Premaratne G, Ali Shojaee S, Lucca DA, Krishnan S. Combined covalent and noncovalent carboxylation of carbon nanotubes for sensitivity enhancement of clinical immunosensors. Chem Commun (Camb). 2016 Oct 27;52(88):13039-13042. View Article
- Singh V, Nerimetla R, Yang M, Krishnan S. Magnetite-Quantum Dot Immunoarray for Plasmon-Coupled-Fluorescence Imaging of Blood Insulin and Glycated Hemoglobin. ACS Sens. 2017 Jul 28;2(7):909-915. View Article
If you publish research with this product, please let us know so we can cite your paper.
