Recombinant Human ACE2-NN-IgG Fc (LALA)-Fusion Protein
Recombinant human ACE2-NN-IgG Fc (LALA)-Fusion Protein expressed in HEK293 cells.
Highlights:
- ACE2-NN is the inactivate form of ACE2
- Prolongs of the plasma half-life (t1/2) of the protein of interest in vivo, resulting in improved therapeutic efficacy
- In vitro applications of Fc-Fusion proteins include immunohistochemistry (IHC), flow cytometry (FC), protein binding assays, and use as microarray baits
- Fc domain-Fusion can also improve the in vivo and in vitro solubility and stability of some binding partners
ACE2 acts as a receptor for human coronaviruses SARS-CoV and SARS-CoV-2, as well as human coronavirus NL63/HCoV-NL63. ACE2-NN is its inactivated mutant form (H374N and H378N mutations).
From our sister company Absolute Antibody.
Recombinant human ACE2-NN-IgG Fc (LALA)-Fusion Protein expressed in HEK293 cells.
Highlights:
- ACE2-NN is the inactivate form of ACE2
- Prolongs of the plasma half-life (t1/2) of the protein of interest in vivo, resulting in improved therapeutic efficacy
- In vitro applications of Fc-Fusion proteins include immunohistochemistry (IHC), flow cytometry (FC), protein binding assays, and use as microarray baits
- Fc domain-Fusion can also improve the in vivo and in vitro solubility and stability of some binding partners
ACE2 acts as a receptor for human coronaviruses SARS-CoV and SARS-CoV-2, as well as human coronavirus NL63/HCoV-NL63. ACE2-NN is its inactivated mutant form (H374N and H378N mutations).
From our sister company Absolute Antibody.
For larger sizes, please Contact Us for a bulk discount.
| Product Type: | Protein |
| Alternative Name(s): | ACE2-NN-Fc chimera; ACE2-NN (Fc tag); ACEH; Metalloprotease MPROT15 |
| Accession ID: | Q9BYF1 |
| Fc domain: | Human IgG1 containing silencing LALA mutations |
| Host: | HEK293 |
| Source: | Recombinant |
| Species: | Human |
| Extinction Coefficient: | 376360 M-1 cm-1 (calculation performed as in Pace et al, 1995) |
| Molecular Weight: | 190493.08 Da |
| Amino Acid Sequence: | QSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKL QLQALQQNGSSVLSEDKSKRLNTILNTMSTIYSTGKVCNPDNPQECLLLEPGLNEIMANSLDYNERLWAWESWRSEV GKQLRPLYEEYVVLKNEMARANHYEDYGDYWRGDYEVNGVDGYDYSRGQLIEDVEHTFEEIKPLYEHLHAYVRAKLM NAYPSYISPIGCLPAHLLGDMWGRFWTNLYSLTVPFGQKPNIDVTDAMVDQAWDAQRIFKEAEKFFVSVGLPNMTQG FWENSMLTDPGNVQKAVCHPTAWDLGKGDFRILMCTKVTMDDFLTAHNEMGNIQYDMAYAAQPFLLRNGANEGFHE AVGEIMSLSAATPKHLKSIGLLSPDFQEDNETEINFLLKQALTIVGTLPFTYMLEKWRWMVFKGEIPKDQWMKKWWEM KREIVGVVEPVPHDETYCDPASLFHVSNDYSFIRYYTRTLYQFQFQEALCQAAKHEGPLHKCDISNSTEAGQKLFNML RLGKSEPWTLALENVVGAKNMNVRPLLNYFEPLFTWLKDQNKNSFVGWSTDWSPYADGGGGSGGGGSDKTHTCPP CPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSV LTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESN GQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Purity: | >95% (SDS-PAGE) |
| Buffer: | PBS, 0.02% Proclin 300 |
| Concentration: | 1 mg/mL |
| Activity: | ACE2 acts as a receptor for human coronaviruses SARS-CoV and SARS-CoV-2, as well as human coronavirus NL63/HCoV-NL63. ACE2-NN is its inactivated mutan |
| Storage: | Recommended storage at +4C for up to 1 month. For longer term storage store at -20C or -80C in appropriate sized aliquots. |
| Shipped: | Cold packs |
ELISA: ACE2 Fc fusion protein binding to immobilized SARS-CoV-2 RBD Fc fusion protein. 96-well plate was coated with the SARS-CoV-2 RBD Fc fusion protein at 5 ug/ml. The ACE2 Fc fusion protein (Kf-Pr00439) were titrated on a 3-fold serial dilution starting at 10 ug/ml.
RBD Fc binding to immobilized ACE2 Fc fusion proteins. 96-well plates were coated with the ACE2 Fc fusion proteins (Kf-Pr00439 and Kf-Pr00441) at 5 ug/ml. The SARS-CoV-2 RBD Fc fusion protein conjugated to HRP was titrated on a 3-fold serial dilution starting at 10 ug/ml.
If you publish research with this product, please let us know so we can cite your paper.
