Fluorescent U-tag SUMO Trapping Protein (KmUTAG-fl)
KmUTAG-fl is a recombinant, mCherry-tagged pan-SUMO-trapping protein. This reagent is used to visualize native, untagged SUMO conjugates and their localization in a variety of cell types.
Highlights:
- Fluorescently labeled SUMO trapping protein
- Visualize native, untagged SUMO conjugates and their localization in a variety of cell types
- Unlike commercially available antibodies it shows reduced affinity for free, unconjugated SUMO.
The purpose of this method is to facilitate the study and analysis of SUMO-conjugated proteins using the recombinant SUMO-trapping UTAG (Ulp domain Tag) protein. As detailed below, UTAG can be used in lieu of other reagents and approaches to purify, detect, and visualize SUMO modified proteins.
From the laboratory of Oliver Kerscher, PhD, College of William & Mary.
KmUTAG-fl is a recombinant, mCherry-tagged pan-SUMO-trapping protein. This reagent is used to visualize native, untagged SUMO conjugates and their localization in a variety of cell types.
Highlights:
- Fluorescently labeled SUMO trapping protein
- Visualize native, untagged SUMO conjugates and their localization in a variety of cell types
- Unlike commercially available antibodies it shows reduced affinity for free, unconjugated SUMO.
The purpose of this method is to facilitate the study and analysis of SUMO-conjugated proteins using the recombinant SUMO-trapping UTAG (Ulp domain Tag) protein. As detailed below, UTAG can be used in lieu of other reagents and approaches to purify, detect, and visualize SUMO modified proteins.
From the laboratory of Oliver Kerscher, PhD, College of William & Mary.
Specifications
| Product Type: | Protein |
| Name: | KmUTAG-fl |
| Accession ID: | BAO38672.1 |
| Source: | recombinant protein produced in E. coli |
| Molecular Weight: | 56.56 (including tags) |
| Amino Acid Sequence: | MIPELSSKDVEAVKATLRRSDNSVLSSKYTLEVSVRDFKTLAPNRWLNDTIIEFFMKYIENNTPKTVAFNSFFYSTLANRGYQGVRRWMKRKKVDILDLERIFIPVNLNDSHWTLGIIDIKNKRILYLDSLSSGANSVSFLIMKNIQSYLIEESKNKLGKDFELCHLDCPQQPNGSDSGIYVCLNTLYMSKNYSLDFNAQDAVNMRVYIGHLILSK |
| Fusion Tag(s): | SPOT tag, mCherry |
| Purity: | affinity-purified |
| Buffer: | 50mM Tris-HCL, pH 8.0, 0.2% NP-40, 150mM NaCl, 5mM TCEP, 10% Glycerol |
| Concentration: | lot dependent |
| Suggested Amount per Experiment: | 1unit |
| Storage: | -80C, aliquot after first thaw. Multible freeze-thaw cycles are not recommended. |
| Shipped: | Dry Ice |
Provider
From the laboratory of Oliver Kerscher, PhD, College of William & Mary.
Comments
KmUTAG-fl has been usesd successfully to visualize SUMO conjugates in normal and carcinogenic tissue culture-grown cell lines. Additionally, it was used to detect SUMO in the nuclei of late meiotic prophase oocytes (see Yin et al., 2019). However, not all samples may lend themselves to analysis with KmUTAG-fl. As with antibody-based protocols, when attempting to localize SUMO variants in new cell types or tissues, detergent choice and detergent concentrations may be important variables.
References
- Yin, R., Harvey, C., Shakes, D. C., Kerscher, O. Localization of SUMO-modified Proteins Using Fluorescent Sumo-trapping Proteins. J. Vis. Exp. (146), e59576, doi:10.3791/59576 (2019).
If you publish research with this product, please let us know so we can cite your paper.
