Anti-DMT1 (SLC11A2) Antibody
This rabbit polyclonal antibody was generated against GST-fusion protein containing 8 tandem repeats of amino acids 4-54 of mouse divalent metal transporter 1 (DMT1) and is reacts with mouse and human DMT1 .
Highlights:
- Reacts with mouse and human DMT1
- Binds to the epitope DPKEKMPDDGASGDHGDSASLGAINPAYSNSSLPHSTGDSEEPFTTYFDEK
- Suitable for Western Blot and Immunohistochemistry applications
Divalent metal transporter 1 (DMT1), also known as solute carrier family 11 member 2 (SLC11A2), natural resistance-associated macrophage protein 2 (NRAMP 2), and divalent cation transporter 1 (DCT1), is part of a large family of metal ion transporter proteins that are highly conserved from bacteria to humans. They are also may play an important role in hepatic iron accumulation and tissue iron distribution.
From the laboratory of Kostas Pantopoulos, PhD, McGill University.
This rabbit polyclonal antibody was generated against GST-fusion protein containing 8 tandem repeats of amino acids 4-54 of mouse divalent metal transporter 1 (DMT1) and is reacts with mouse and human DMT1 .
Highlights:
- Reacts with mouse and human DMT1
- Binds to the epitope DPKEKMPDDGASGDHGDSASLGAINPAYSNSSLPHSTGDSEEPFTTYFDEK
- Suitable for Western Blot and Immunohistochemistry applications
Divalent metal transporter 1 (DMT1), also known as solute carrier family 11 member 2 (SLC11A2), natural resistance-associated macrophage protein 2 (NRAMP 2), and divalent cation transporter 1 (DCT1), is part of a large family of metal ion transporter proteins that are highly conserved from bacteria to humans. They are also may play an important role in hepatic iron accumulation and tissue iron distribution.
From the laboratory of Kostas Pantopoulos, PhD, McGill University.
| Product Type: | Antibody |
| Antigen: | Mouse DMT1 |
| Accession ID: | P49281 |
| Molecular Weight: | 62 kDa |
| Clonality: | Polyclonal |
| Reactivity: | Mouse and human |
| Immunogen: | GST-fusion protein containing 8 tandem repeats of amino acids 4-54 of mouse Dmt-1 |
| Species Immunized: | Rabbit |
| Epitope: | DPKEKMPDDGASGDHGDSASLGAINPAYSNSSLPHSTGDSEEPFTTYFDEK |
| Purification Method: | To remove antibodies that were generated against the GST moiety, serum was purified by absorption through an affinity column of immobilized GST (Pierce) |
| Buffer: | Serum with 0.05% sodium azide |
| Tested Applications: | WB (1:1000), IHC (1:500) |
| Storage: | -80C |
| Shipped: | Cold Packs (Domestic, Overnight); Dry Ice (International) |
- Schümann K, Herbach N, Kerling C, Seifert M, Fillebeen C, Prysch I, Reich J, Weiss G, Pantopoulos K. Iron absorption and distribution in TNF(DeltaARE/+) mice, a model of chronic inflammation. J Trace Elem Med Biol. 2010 Jan;24(1):58-66.
- Maffettone C, Chen G, Drozdov I, Ouzounis C, Pantopoulos K. Tumorigenic properties of iron regulatory protein 2 (IRP2) mediated by its specific 73-amino acids insert. PLoS One. 2010 Apr 13;5(4):e10163.
If you publish research with this product, please let us know so we can cite your paper.
