Anti-Hemojuvelin (HFE2) Antibody

This rabbit polyclonal antibody was generated against GST-fusion protein containing a 77 amino acid region of mouse hemojuvelin (HJV) and recognizes human and mouse HJV.

Highlights:

  • Reacts with human and mouse HFE2
  • Binds to the epitope RQTAGQLSFSIRVAEDVARAFSAEQDLQLCVGGCPPSQRLSRSERNRRGAIAIDTARRLCKEGLPVEDAYFQSCVFD
  • Suitable for Western Blot applications

Hemojuvelin (HJV), also known as repulsive guidance molecule C (RGMc) or hemochromatosis type 2 protein (HFE2), is a member of the repulsive guidance molecule family of proteins. The protein in mammals is membrane-bound and soluble and is responsible for the iron overload condition known as juvenile hemochromatosis in humans, a severe form of hemochromatosis.

From the laboratory of Kostas Pantopoulos, PhD, McGill University.

Catalog Number Product Size AVAILABILITY Price Qty
EMG011
Anti-Hemojuvelin (HFE2) Antibody), 100uL
100uL In stock
Price: $299.00
Specifications
Product Type: Antibody
Antigen: Mouse HFE2
Accession ID: Q7TQ32
Molecular Weight: 50 kDa
Clonality: Polyclonal
Reactivity: Human and Mouse
Immunogen: GST-fusion protein containing a 77 amino acid region of mouse HFE2
Species Immunized: Rabbit
Epitope: RQTAGQLSFSIRVAEDVARAFSAEQDLQLCVGGCPPSQRLSRSERNRRGAIAIDTARRLCKEGLPVEDAYFQSCVFD
Purification Method: To remove antibodies that were generated against the GST moiety, serum was purified by absorption through an affinity column of immobilized GST (Pierce)
Buffer: Serum with 0.05% sodium azide
Tested Applications: WB (1:2000)
Storage: -80C
Shipped: Dry Ice
Provider
From the laboratory of Kostas Pantopoulos, PhD, McGill University.
References

If you publish research with this product, please let us know so we can cite your paper.

 
Loading...
Loading...