KmUD SUMO Protease

KmUD is a recombinant temperature- and stress-resistant SUMO protease (UD) domain of Kluyveromyces marxianus Ulp1.

Highlights:

  • Can be used to digest recombinant SUMO fusion protein and sumoylated proteins
  • Exhibits robust SUMO-processing properties under a variety of conditions that include oxidative stress (0.6% H202), heat stress (37C), and protein denaturing reagents (2M Urea)

Proteins from Klyveromyces marxianus exhibit superior stability when exposed to high temperature and chemical insults relative to their budding yeast orthologs. This makes KmUD uniquely suited for the digestion of sumoylated proteins under a variety of buffer and reaction conditions.

From the laboratory of Oliver Kerscher, PhD, College of William & Mary.

Catalog Number Product Size AVAILABILITY Price Qty
EWM102
KmUD SUMO Protease, 100 Units
100 Units In stock
Price: $99.00
Specifications
Product Type: Protein
Name: kmUD
Accession ID: Based on NCBI Gene ID: 34714692
Molecular Weight: 67240 Da
Fusion Tag(s): MBP and HIS6
Amino Acid Sequence: IPELSSKDVEAVKATLRRSDNSVLSSKYTLEVSVRDFKTLAPNRWLNDTIIEFFMKYIENNTPKTVAFNSFFYSTLANRGYQGVRRWMKRKKVDILDLERIFIPVNLNDSHWTLGIIDIKNKRILYLDSLSSGANSVSFLIMKNIQSYLIEESKNKLGKDFELCHLDCPQQPNGSDCGIYVCLNTLYMSKNYSLDFNAQDAVNMRVYIGHLILSK
Buffer: 25mM Tris-HCl, pH. 8.0, 1% NP-40, 250mM NaCl, 5mM TCEP, 50% glycerol
Source: Recombinant
Purity: 98%
Concentration: 1 Unit/uL
Activity: 1 Unit will digest 5ug of recombinant SUMO-CAT in 1h at 30-37C
Suggested Amount per Experiment: 1 Unit KmUD/20 uL reaction containing 2-5ug of SUMO-CAT or substrate of choice
Comments: Can be removed from digestion reaction owing to HIS6-tag
Storage: -80C
Shipped: Dry Ice
Provider
From the laboratory of Oliver Kerscher, PhD, College of William & Mary
References
  1. Peek et al., (submitted).

If you publish research with this product, please let us know so we can cite your paper.

 
Loading...
Loading...