KmUD SUMO Protease
KmUD is a recombinant temperature- and stress-resistant SUMO protease (UD) domain of Kluyveromyces marxianus Ulp1.
Highlights:
- Can be used to digest recombinant SUMO fusion protein and sumoylated proteins
- Exhibits robust SUMO-processing properties under a variety of conditions that include oxidative stress (0.6% H202), heat stress (37C), and protein denaturing reagents (2M Urea)
Proteins from Klyveromyces marxianus exhibit superior stability when exposed to high temperature and chemical insults relative to their budding yeast orthologs. This makes KmUD uniquely suited for the digestion of sumoylated proteins under a variety of buffer and reaction conditions.
From the laboratory of Oliver Kerscher, PhD, College of William & Mary.
KmUD is a recombinant temperature- and stress-resistant SUMO protease (UD) domain of Kluyveromyces marxianus Ulp1.
Highlights:
- Can be used to digest recombinant SUMO fusion protein and sumoylated proteins
- Exhibits robust SUMO-processing properties under a variety of conditions that include oxidative stress (0.6% H202), heat stress (37C), and protein denaturing reagents (2M Urea)
Proteins from Klyveromyces marxianus exhibit superior stability when exposed to high temperature and chemical insults relative to their budding yeast orthologs. This makes KmUD uniquely suited for the digestion of sumoylated proteins under a variety of buffer and reaction conditions.
From the laboratory of Oliver Kerscher, PhD, College of William & Mary.
Specifications
| Product Type: | Protein |
| Name: | kmUD |
| Accession ID: | Q02724, 34714692 |
| Source: | Recombinant |
| Molecular Weight: | 67240 Da |
| Amino Acid Sequence: | IPELSSKDVEAVKATLRRSDNSVLSSKYTLEVSVRDFKTLAPNRWLNDTIIEFFMKYIENNTPKTVAFNSFFYSTLANRGYQGVRRWMKRKKVDILDLERIFIPVNLNDSHWTLGIIDIKNKRILYLDSLSSGANSVSFLIMKNIQSYLIEESKNKLGKDFELCHLDCPQQPNGSDCGIYVCLNTLYMSKNYSLDFNAQDAVNMRVYIGHLILSK |
| Fusion Tag(s): | MBP and HIS6 |
| Purity: | 98% |
| Buffer: | 25mM Tris-HCl, pH. 8.0, 1% NP-40, 250mM NaCl, 5mM TCEP, 50% glycerol |
| Concentration: | 1 Unit/uL |
| Activity: | 1 Unit will digest 5ug of recombinant SUMO-CAT in 1h at 30-37C |
| Suggested Amount per Experiment: | 1 Unit KmUD/20 uL reaction containing 2-5ug of SUMO-CAT or substrate of choice |
| Comments: | Can be removed from digestion reaction owing to HIS6-tag |
| Storage: | -80C |
| Shipped: | Dry Ice |
Provider
From the laboratory of Oliver Kerscher, PhD, College of William & Mary
References
- Peek J, Harvey C, Gray D, Rosenberg D, Kolla L, Levy-Myers R, Yin R, McMurry JL, Kerscher O. SUMO targeting of a stress-tolerant Ulp1 SUMO protease. PLoS One. 2018 Jan 19;13(1):e0191391. doi: 10.1371/journal.pone.0191391.
If you publish research with this product, please let us know so we can cite your paper.
