Anti-Influenza A (H5N1) Hemagglutinin (HA) Antibodies

These mouse IgG1 monoclonal antibodies were generated against Influenza A virus (H5N1) hemagglutinin (HA) recombinant protein and recognize Influenza A virus (H5N1) HA.

Highlights:

  • Reacts with Influenza A virus (H5N1) HA1
  • Recognizes the epitope NVPEWSYIVEKANPANDLCYPGNFNDYEELKHLLSRINHFEKIQ
  • Suitable for Western Blot and H5N1 Neutralization applications

Influenza A virus subtype H5N1, also known as A(H5N1) or simply H5N1, is a subtype of the influenza A virus. It has been known to be called "bird flu" or avian influenza. Limited cases have been seen in humans, but those that were infected had a high mortality rate of 60%. Hemagglutinin causes red blood cells to clump together and binds the virus to the infected cell.

From the laboratories of Shibo Jiang, MD, PhD and Lanying Du, PhD, New York Blood Center.

Catalog Number Product Size AVAILABILITY Price Qty
ENB020
Anti-Influenza A (H5N1) Hemagglutinin (HA) [HA-3] Antibody, 100ug
100ug 3-5 weeks
Price: $299.00
ENB021
Anti-Influenza A (H5N1) Hemagglutinin (HA) [HA-7] Antibody, 100ug
100ug 3-5 weeks
Price: $299.00
Specifications
Product Type: Antibody
Antigen: Influenza A virus H5N1 HA1-Fdc (e.g., HA1-Fd-hFc)
Accession ID: ABD28180
Molecular Weight: 100 kDa
Clonality: Monoclonal
Clone Name: See table above
Reactivity: Influenza A virus (H5N1)
Immunogen: H5N1 hemagglutinin (HA) recombinant protein
Species Immunized: Mouse
Epitope: NVPEWSYIVEKANPANDLCYPGNFNDYEELKHLLSRINHFEKIQ
Purification Method: Protein A/G
Buffer: 0.1M Sodium Phosphate, pH 7.4, 0.15M NaCl, 0.05% (w/v) Sodium Azide
Tested Applications: Western blot (1ug/ml), Neutralization studies
Storage: -20C
Shipped: Cold packs
Provider
From the laboratories of Shibo Jiang, MD, PhD and Lanying Du, PhD, New York Blood Center.
References
  1. Lanying Du, Virtual Ho-Chuen Leung, Xiujuan Zhang, Jie Zhou, Min Chen, Wu He, Hai-Ying Zhang, Chris C.S Chan, Vincent Kwok-Man Poon, Guangyu Zhao, Shihui Sun, Lifeng Cai, Yusen Zhou, Bo-Jian Zheng, Shibo Jiang. A Recombinant Vaccine of H5N1 HA1 Fused with Foldon and Human IgG Fc Induced Complete Cross-Clade Protection against Divergent H5N1 Viruses. PLoS One. 2011, 6 (1) e16555; DOI: 10.1371/journal.pone.0016555.
  2. Lanying Du, Lei Jin, Guangyu Zhao, Shihui Sun, Junfeng Li, Hong Yu, Ye Li, Bo-Jian Zheng, Robert C Liddington, Yusen Zhou, Shibo Jiang. Identification and Structural Characterization of a Broadly Neutralizing Antibody Targeting a Novel Conserved Epitope on Influenza H5N1 Hemagglutinin. J Virol. February 2013, 87 (4) 2215-2225; DOI: 10.1128/JVI.02344-12.
  3. Shibo Jiang, Lanying Du, Yusen Zhou. Influenza Hemagglutinin-Specific Monoclonal Antibodies for Preventing and Treating Influenza Virus Infection. U.S. Patent No. US 8,900,585 B2. December 02, 2014.

If you publish research with this product, please let us know so we can cite your paper.

 
Loading...
Loading...