Anti-Zika Virus Envelope (E) Protein, ED3 Domain [3E10D1] Antibody

This mouse monoclonal antibody was generated against the ED3 domain of the Zika virus E protein, and recognizes ZIKV E protein, ED3 domain .


  • Recognizes Zika virus E protein
  • Specific for the ED3 domain of ZIKV E protein
  • Suitable for Immunofluorescence and Western Blot applications

Zika virus (ZIKV) is a member of the virus family Flaviviridae and the genus Flavivirus, transmitted by daytime-active Aedes mosquitoes. Zika is related to other mosquito transmitted viruses such as dengue, yellow fever, Japanese encephalitis and West Nile. Similar to other flaviviruses, ZIKV is enveloped and icosahedral and has a nonsegmented, single-stranded, positive-sense RNA genome. Common symptoms of infection with the virus include mild headaches, maculopapular rash, fever, malaise, conjunctivitis, and joint pains.

From the laboratory of Donghoon Chung, PhD, University of Louisville.

Catalog Number Product Size AVAILABILITY Price Qty
Anti-Zika Virus Envelope (E) Protein, ED3 Domain [3E10D1] Antibody, 100ug
100ug In stock
Price: $306.00
Product Type: Antibody
Organism: mouse
Antigen: Zika virus ED3
Accession ID: A0A1C8L488
Molecular Weight: 12.1 kDa
Isotype: IgG2b,k
Clonality: Monoclonal
Clone Name: 3E10D1
Reactivity: Zika virus
Immunogen: Bacterial expressed ED3 (dklrlkgvsyslctaaftftkipaetlhgtvtvevqyagtdgpckvpaqmavdmqtltpvgrlitanpvitestenskmmleldppfgdsyivigvgekkithhwhrsgsti)
Epitope: Zika ED3
Purification Method: Protein G
Tested Applications: IF (1: 2000); showed suitability for WB and IFA (1µg/ml for WB and 0.1-10µg/mL for IFA)
Storage: -20C
Shipped: Cold packs
From the laboratory of Donghoon Chung, PhD, University of Louisville.

If you publish research with this product, please let us know so we can cite your paper.
