Anti-Gamma-Glutamylcysteine Synthetase (γ-ECS) Antibodies
These mouse IgG2a monoclonal antibodies were generated against synthetic peptide and recognize E. coli, plants and fission yeast (Schizosaccharomyces pombe ) gamma glutamyl Cys sythetase (γ-ECS), N terminal-MAP.
Highlights:
- Recognize E. coli, plants and fission yeast (Schizosaccharomyces pombe) gamma glutamyl Cys sythetase (γ-ECS), N terminal-MAP
- Antibodies developed using N-MAP gamma glutamyl Cys synthetase (γ-ECS). NMAP SEQ (30 aa) IPDVSQALAWLEKHPQALKGIQRGLERETL
- Useful for the study of synthesis of, and development of, phytochelatins and related metabolic pathways, as well as in the development of phytoremediation tools, and in the study of metal toxicity in plants and closely related organisms
- Suitable fo ELISA, Immunofluorescence and Western Blot applications
Together with glutathione synthetase and phytochelatin synthetase, gamma glutamyl Cys sythetase (γ-ECS) is an enzyme involved in, and required for, synthesizing phytochelatins (PC). PC are multidentate ligands that are able to form chelates with thio-reactive, soft metal cations such as Cd2+, Hg2+, and at least one oxoanion (AsO33-). In certain plants, deficiency of such enzymes leads to low tolerance to metal contamination while mutants over-expressing them are highly tolerant to metal contamination and may be used in phyto-remediation of heavy metals.
From the laboratory of Richard B. Meagher, PhD, University of Georgia.
These mouse IgG2a monoclonal antibodies were generated against synthetic peptide and recognize E. coli, plants and fission yeast (Schizosaccharomyces pombe ) gamma glutamyl Cys sythetase (γ-ECS), N terminal-MAP.
Highlights:
- Recognize E. coli, plants and fission yeast (Schizosaccharomyces pombe) gamma glutamyl Cys sythetase (γ-ECS), N terminal-MAP
- Antibodies developed using N-MAP gamma glutamyl Cys synthetase (γ-ECS). NMAP SEQ (30 aa) IPDVSQALAWLEKHPQALKGIQRGLERETL
- Useful for the study of synthesis of, and development of, phytochelatins and related metabolic pathways, as well as in the development of phytoremediation tools, and in the study of metal toxicity in plants and closely related organisms
- Suitable fo ELISA, Immunofluorescence and Western Blot applications
Together with glutathione synthetase and phytochelatin synthetase, gamma glutamyl Cys sythetase (γ-ECS) is an enzyme involved in, and required for, synthesizing phytochelatins (PC). PC are multidentate ligands that are able to form chelates with thio-reactive, soft metal cations such as Cd2+, Hg2+, and at least one oxoanion (AsO33-). In certain plants, deficiency of such enzymes leads to low tolerance to metal contamination while mutants over-expressing them are highly tolerant to metal contamination and may be used in phyto-remediation of heavy metals.
From the laboratory of Richard B. Meagher, PhD, University of Georgia.
| Catalog Number | Product | DataSheet | Size | AVAILABILITY | Price | Qty |
|---|
| Product Type: | Antibody |
| Antigen: | Gamma glutamyl Cys sythetase (γ-ECS), N-MAP |
| Accession ID: | Q9W3K5 |
| Molecular Weight: | 57 kDa |
| Isotype: | IgG2a |
| Clonality: | Monoclonal |
| Clone Name: | 11H7.C1.A2, 16D8.H3.F2 or 3D7.C2.F8.G11 |
| Reactivity: | E. coli, plants and fission yeast (Schizosaccharomyces pombe). Possibly, other closely related organisms |
| Immunogen: | Synthetic peptide |
| Species Immunized: | Mouse with N-MAP derivative |
| Purification Method: | Protein G |
| Buffer: | PBS, 0.05% (w/v) Sodium Azide |
| Tested Applications: | WB, ELISA, IF |
| Storage: | -20C |
| Shipped: | Cold packs |
- Li Y, Kandasamy MK, Meagher RB. Rapid isolation of monoclonal antibodies. Monitoring enzymes in the phytochelatin synthesis pathway. Plant Physiol. 2001 Nov;127(3):711-9. PubMed PMID: 11706154; PubMed Central PMCID: PMC1540151.
- LeBlanc MS, Lima A, Montello P, Kim T, Meagher RB, Merkle S. Enhanced arsenic tolerance of transgenic eastern cottonwood plants expressing gamma-glutamylcysteine synthetase. Int J Phytoremediation. 2011 Aug;13(7):657-73. PubMed PMID: 21972493.
- Li Y, Dhankher OP, Carreira L, Balish RS, Meagher RB. Arsenic and mercury tolerance and cadmium sensitivity in Arabidopsis plants expressing bacterial gamma-glutamylcysteine synthetase. Environ Toxicol Chem. 2005 Jun;24(6):1376-86. PubMed PMID: 16117113.
- Dhankher OP, Li Y, Rosen BP, Shi J, Salt D, Senecoff JF, Sashti NA, Meagher RB. Engineering tolerance and hyperaccumulation of arsenic in plants by combining arsenate reductase and gamma-glutamylcysteine synthetase expression. Nat Biotechnol. 2002 Nov;20(11):1140-5.
If you publish research with this product, please let us know so we can cite your paper.
