Human S100A8/A9 Heterodimer (Calprotectin)
Recombinant human S100A8/A9 heterodimer complex (Calprotectin) protein expressed in and purified from E. coli.
Highlights:
- Highly pure (>95%)
- Fully functional - Quality control growth assays on each batch confirm protein activity
- Endotoxin free version available - Ideal for cell-based studies
Calprotectin (CP), also known as MRP-8/MRP-14 or S100A8/A9 heterocomplex, is a critical factor in the innate immune response to a wide range of microbial pathogens. CP functions in this role via a mechanism termed nutritional immunity, by sequestering essential transition metals required for growth and vitality. Recent literature has identified instances where over-accumulation of calprotectin can play a key role in inflammatory diseases, multiple forms of arthritis, tumor metastasis and sepsis. In the inflammatory response it has been shown that CP binding to extracellular receptors like pattern recognition proteins RAGE (Receptor for Advanced Glycation Endproducts) and Toll-like receptors (TLR) induce a positive feedback loop that promotes infection.
From the laboratory of Walter J. Chazin, PhD, Vanderbilt University.
Part of The Investigator's Annexe program.
Recombinant human S100A8/A9 heterodimer complex (Calprotectin) protein expressed in and purified from E. coli.
Highlights:
- Highly pure (>95%)
- Fully functional - Quality control growth assays on each batch confirm protein activity
- Endotoxin free version available - Ideal for cell-based studies
Calprotectin (CP), also known as MRP-8/MRP-14 or S100A8/A9 heterocomplex, is a critical factor in the innate immune response to a wide range of microbial pathogens. CP functions in this role via a mechanism termed nutritional immunity, by sequestering essential transition metals required for growth and vitality. Recent literature has identified instances where over-accumulation of calprotectin can play a key role in inflammatory diseases, multiple forms of arthritis, tumor metastasis and sepsis. In the inflammatory response it has been shown that CP binding to extracellular receptors like pattern recognition proteins RAGE (Receptor for Advanced Glycation Endproducts) and Toll-like receptors (TLR) induce a positive feedback loop that promotes infection.
From the laboratory of Walter J. Chazin, PhD, Vanderbilt University.
Part of The Investigator's Annexe program.
| Catalog Number | Product | DataSheet | Size | AVAILABILITY | Price | Qty |
|---|
| Product Type: | Protein |
| Name: | Calprotectin, MRP-8/MRP-14, S100A8/A9 |
| Accession ID: | P05109, P06702, HS07074, HS08809 |
| Source: | Recombinant (E. coli), bacterial overexpression |
| Molecular Weight: | 23,945 Da |
| Amino Acid Sequence: | MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE/TCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP |
| Purity: | >95%, endotoxin-free |
| Buffer: | 20 mM Tris pH 8.0, 100 mM NaCl, 10 mM ?-mercaptoethanol |
| Concentration: | 8.3mg/mL (EVU202, EVU204); 12.2mg/mL (EVU201, EVU203) |
| Comments: | Quality control growth assays are performed on each batch of protein, ensuring that the protein is active |
| Storage: | -80C |
| Shipped: | Dry ice |
- Kehl-Fie TE, Chitayat S, Hood MI, Damo S, Restrepo N, Garcia C, Munro KA, Chazin WJ, Skaar EP. Nutritional metal sequestration by calprotectin enhances neutrophil killing of Staphylococcus aureus through inhibition of superoxide defense. Cell Host and Microbe 10, 158-164 (2011).
- Damo SM, Kehl-Fie TE, Sugitani N, Holt ME, Rathi S, Murphy WJ, Zhang Y, Betz C, Hench L, Fritz G, Skaar EP, Chazin WJ. Molecular basis for manganese sequestration by calprotectin and roles in the innate immune response to invading bacterial pathogens". Proc. Natl. Acad. Sci., USA 110, 3841-3846 (2013).
If you publish research with this product, please let us know so we can cite your paper.
