Biotinylated-Trx Loading Control Protein
This biotinylated bacterial protein can be used as a procedural control for affinity capture experiments using avidin or streptavidin beads and biotinylated proteins.
Highlights:
- Reliable procedural and loading control for biotin-based affinity experiments
- Small (~12 kDa) size - Easily detected via Western blot using commercially avaliable anti-E. coli Trx antibodies
- Compatible with all biotin-based cysteine oxidation probes
Avidin and streptavidin are widely used in biotechnology and molecular research for detection, purification, crosslinking, and labeling of biotinylated targets. This protein can be used in a manner similar to the way prebiotinylated AhpC was used in experiments with DCP-Bio1 (discussed in Klomsiri et al., Methods Enzymol, 2010).
From the laboratory of Leslie B. Poole, PhD, Wake Forest School of Medicine.
Part of The Investigator's Annexe program.
This biotinylated bacterial protein can be used as a procedural control for affinity capture experiments using avidin or streptavidin beads and biotinylated proteins.
Highlights:
- Reliable procedural and loading control for biotin-based affinity experiments
- Small (~12 kDa) size - Easily detected via Western blot using commercially avaliable anti-E. coli Trx antibodies
- Compatible with all biotin-based cysteine oxidation probes
Avidin and streptavidin are widely used in biotechnology and molecular research for detection, purification, crosslinking, and labeling of biotinylated targets. This protein can be used in a manner similar to the way prebiotinylated AhpC was used in experiments with DCP-Bio1 (discussed in Klomsiri et al., Methods Enzymol, 2010).
From the laboratory of Leslie B. Poole, PhD, Wake Forest School of Medicine.
Part of The Investigator's Annexe program.
| Catalog Number | Product | DataSheet | Size | AVAILABILITY | Price | Qty |
|---|
Specifications
| Product Type: | Protein |
| Name: | Biotinylated-Trx Loading Control Protein |
| Accession ID: | P10599, P0AA25 |
| Source: | Recombinantly expressed in E.Coli and modified with biotin-maleimide |
| Molecular Weight: | 11,675 + 903 Da (2 biotin molecules) |
| Amino Acid Sequence: | SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA |
| Fusion Tag(s): | None |
| Purity: | 95% as determined by SDS-PAGE |
| Buffer: | 25mM potassium phosphate pH 7, 1mM EDTA |
| Concentration: | 1mg/mL |
| Suggested Amount per Experiment: | 1 microgram per 1000 micrograms of sample |
| Comments: | Has 2 biotin-maleimide moieties attached at Cys residues |
| Storage: | -20C (avoid repeated freeze-thaw cycles) |
| Shipped: | Cold packs |
Provider
From the laboratory of Leslie B. Poole, PhD, Wake Forest School of Medicine.
References
- Klomsiri, C., Nelson, K.J., Bechtold, E., Soito, L., Johnson, L.C., Lowther, W.T., Ryu, S.E., King, S.B., Furdui, C.M. & Poole, L.B. Use of dimedone-based chemical probes for sulfenic acid detection: evaluation of conditions affecting probe incorporation into redox-sensitive proteins. Methods Enzymol 473, 77-94 (2010). PMC3795394
If you publish research with this product, please let us know so we can cite your paper.
