Feedback
Lunasin, Natural Killer (NK) Cell Activating Peptide


Lunasin, Natural Killer (NK) Cell Activating Peptide

Lunasin, Natural Killer (NK) Cell Activating Peptide

Lunasin is an immune modulating agent that activates Natural Killer (NK) cells. This peptide exerts robust synergistic effects imposed by other NK stimulating agents (e.g., cytokines and TLR agonists) on modulating gene expression.

Induces the following genes: IFNG, GZMB, CSF2 (GM-CSF).

Suppresses the following genes: TGFB1, TGFBR2.

Lunasin is a small peptide that was originally isolated from soybeans (Glycine max), where it is a component of larger 2S albumin seed-storage protein complexes. It has been known for more than a decade that lunasin has cancer preventive properties and has direct anti-mitotic effects by inducing apoptosis of transformed cells.

From the laboratory of Hua-Chen Chang, PhD, Indiana University.

The Investigator's Annexe Part of The Investigator's Annexe program.

Catalog Number Product Description Price Order
EIU001 Lunasin, Natural Killer (NK) Cell Activating Peptide, 100uL  5mM (100uL) Price: $305.00 
Qty:  

Lunasin, Natural Killer (NK) Cell Activating Peptide

Peptide Name: Lunasin
NCBI Ref: NP_001238443.1
Amino Acid Sequence:
SKWQHQQDSCRKQLQGVNLTPCEKHIMEKIQGRGDDDDDDDDD
Molecular Weight: 4.4 kDa
Fusion Tag: None
Special Characteristics: Lunasin is highly negative charged (net charge at pH 5.9-7.0), and very water soluble.
Purity: >98%
Source: Chemically synthesized
Volume: 100 uL
Concentration: 5 mM
Buffer Composition: Sterilized water
Storage Temperature: 4C for up to 3 months without losing activity (do not freeze)
Shipped: Cold pack

Comments

Each 100 uL unit is provided at 5 mM (Use 4 uL per 1 mL of culture) and good for 25 reactions (one reaction is for 1x10^6 NK cells/1mL cell culture medium).

NK activating agents: Lunasin (final at 20 uM) + Cytokine* (e.g., human IL-2 at 100 units/ml)

*Cytokine can be IL-2, IL-12, IL-15, IL-18, IL-21, IFNα (or Poly-IC as TLR agonist).

The Chang lab recently identified lunasin as an immune modulating agent that activates NK cells (Lewis D, et al., manuscript submitted). While lunasin by itself is capable of modulating gene expression, lunasin exerts robust synergistic effects with various NK-stimulating agents (e.g., cytokines and TLR agonists) on regulating expression of various genes (e.g., IFN-gamma and granzyme B), which are important for NK functions. This synergism also augments the natural cytotoxicity of human and mouse NK cells against not only hematopoietic malignancy but also solid tumors in vitro. The underlying mechanism responsible for lunasin’s effects on modulating gene expression by NK cells is in part through epigenetic regulation. Thus, the novel property of lunasin represents a different class of immune modulating agent that may act as an epigenetic regulator to regulate gene expression in NK cells.

References

  1. Odani S, Koide T, Ono T. Amino acid sequence of a soybean (Glycine max) seed polypeptide having a poly(L-aspartic acid) structure. The Journal of Biological Chemistry. 262(22):10502-10505, (1987).
  2. Chang HC, Lewis D, Tung CY, Han L, Henriquez SM, Voiles L, Lupov IP, Pelloso D, Sinn AL, Pollok KE, de Lumen BO, Li F, Blum JS, Srivastava S, Robertson MJ. 2012. Soypeptide lunasin in cytokine immunotherapy for lymphoma.Cancer Immunol Immunother. 2014 Mar;63(3):283-95.

If you publish research with this product, please let us know so we can cite your paper.